KEGG   Staphylococcus aureus subsp. aureus MSHR1132: SAMSHR1132_12160Help
Entry
SAMSHR1132_12160  CDS       T01767                                 

Definition
tryptophan synthase alpha chain (EC:4.2.1.20)
Orthology
K01695  
tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
suh  Staphylococcus aureus subsp. aureus MSHR1132
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:suh00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    SAMSHR1132_12160
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    SAMSHR1132_12160
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    SAMSHR1132_12160
Enzymes [BR:suh01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     SAMSHR1132_12160
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1358291..1359019
Genome map
AA seq 242 aa AA seqDB search
MTKLFIPYIMGDKDFIENATLLSEHGADIIEIGVPFSDPVADGPVIMEAGQQAIKQGITI
DYIFEQLEKHGNQIKCHYVLMTYYNIICHYGEQAFFEKCRDTGVYGLIIPDLPYELSQRL
KQQCSHYGVKIISLVAMTTDDKRIRNIVSQAEGFIYTVTMNATTGQNGAFHPELKQKIES
IKAIANVPVVAGFGIRTPQHVADIKEVADGIVIGSEIVKQFKANSQEEIITYLQTIKQAL
NN
NT seq 729 nt NT seq  +upstreamnt  +downstreamnt
atgactaaattatttataccttatattatgggagataaagactttattgaaaatgcaaca
ttgttgagtgaacatggtgccgacatcattgaaattggcgtacctttctctgatccggtt
gctgatggtccagttatcatggaagcaggacaacaagcgattaaacaaggtatcacgata
gattatattttcgaacaattagaaaaacacggtaatcaaattaagtgtcactatgtatta
atgacgtattataatattatttgtcattatggagaacaagcgttttttgaaaaatgtcga
gatactggtgtctacggcttaattattcccgatttaccatatgaattatcacagcgctta
aaacaacaatgcagccattatggtgttaaaattatatcgttagttgctatgactactgat
gacaaacgtataagaaatattgtgtcgcaggcagaaggatttatatacactgtaacgatg
aatgctacaacaggacaaaacggagcttttcatccagaattaaaacaaaaaattgagtca
attaaagcgatagccaatgtaccagttgtcgcaggatttggtataagaacaccacaacat
gttgcagatataaaagaggttgcagatggtatcgtcattggcagcgaaattgttaagcaa
tttaaagctaactcacaagaggaaataattacctaccttcaaacaatcaaacaggcattg
aacaattaa

DBGET integrated database retrieval system