KEGG   Staphylococcus aureus subsp. aureus MSHR1132: SAMSHR1132_12160Help
Entry
SAMSHR1132_12160  CDS       T01767                                 

Definition
tryptophan synthase alpha chain (EC:4.2.1.20)
Orthology
K01695  
tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
suh  Staphylococcus aureus subsp. aureus MSHR1132
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:suh01230]
Metabolism; Amino acid metabolism; Glycine, serine and threonine metabolism [PATH:suh00260]
Metabolism; Amino acid metabolism; Phenylalanine, tyrosine and tryptophan biosynthesis [PATH:suh00400]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1358291..1359019
Genome map
AA seq 242 aa AA seqDB search
MTKLFIPYIMGDKDFIENATLLSEHGADIIEIGVPFSDPVADGPVIMEAGQQAIKQGITI
DYIFEQLEKHGNQIKCHYVLMTYYNIICHYGEQAFFEKCRDTGVYGLIIPDLPYELSQRL
KQQCSHYGVKIISLVAMTTDDKRIRNIVSQAEGFIYTVTMNATTGQNGAFHPELKQKIES
IKAIANVPVVAGFGIRTPQHVADIKEVADGIVIGSEIVKQFKANSQEEIITYLQTIKQAL
NN
NT seq 729 nt NT seq  +upstreamnt  +downstreamnt
atgactaaattatttataccttatattatgggagataaagactttattgaaaatgcaaca
ttgttgagtgaacatggtgccgacatcattgaaattggcgtacctttctctgatccggtt
gctgatggtccagttatcatggaagcaggacaacaagcgattaaacaaggtatcacgata
gattatattttcgaacaattagaaaaacacggtaatcaaattaagtgtcactatgtatta
atgacgtattataatattatttgtcattatggagaacaagcgttttttgaaaaatgtcga
gatactggtgtctacggcttaattattcccgatttaccatatgaattatcacagcgctta
aaacaacaatgcagccattatggtgttaaaattatatcgttagttgctatgactactgat
gacaaacgtataagaaatattgtgtcgcaggcagaaggatttatatacactgtaacgatg
aatgctacaacaggacaaaacggagcttttcatccagaattaaaacaaaaaattgagtca
attaaagcgatagccaatgtaccagttgtcgcaggatttggtataagaacaccacaacat
gttgcagatataaaagaggttgcagatggtatcgtcattggcagcgaaattgttaagcaa
tttaaagctaactcacaagaggaaataattacctaccttcaaacaatcaaacaggcattg
aacaattaa

DBGET integrated database retrieval system