KEGG   Staphylococcus aureus subsp. aureus MSHR1132: SAMSHR1132_12530Help
Entry
SAMSHR1132_12530  CDS       T01767                                 

Definition
dihydrolipoamide succinyltransferase E2 component of 2-oxoglutarate dehydrogenase complex (EC:2.3.1.61)
Orthology
K00658  
2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
suh  Staphylococcus aureus subsp. aureus MSHR1132
Pathway
Citrate cycle (TCA cycle)
Lysine degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:suh00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    SAMSHR1132_12530
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    SAMSHR1132_12530
  Amino acid metabolism
   00310 Lysine degradation
    SAMSHR1132_12530
Enzymes [BR:suh01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     SAMSHR1132_12530
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1396278..1397546)
Genome map
AA seq 422 aa AA seqDB search
MPEVKVPELAESITEGTIAEWLKNVGDSVEKGEAILELETDKVNVEVVSEEAGVLFEQLA
SEGDTVEVGQAIAVIGEGSGNASNESEKDKDKTPQQKDETENNKEEKVTGDDSTESKTSD
DNQQRVNATPSARRYARENGVNLAEVSPKTNDVLRKEDIDKKQDAPASTPTSQKTPAKEE
KKYNQYPSKPVIREKMSRRKKTAAKKLLEVSNNTAMLTTFNEVDMTNVMELRKRKKEQFM
KDHDGTKLGFMSFFTKASVAALKKYPEVNAEIDGEDMITKQYYDIGVAVSTDDGLLVPFV
RDCDKKNFAEIEAEIANLAVKAREKKLGLDDMVNGSFTITNGGIFGSMMSTPIINGNQAA
ILGMHSIITRPIAIDQDTIENRPMMYIALSYDHRIIDGKEAVGFLKTIKELIENPEDLLL
ES
NT seq 1269 nt NT seq  +upstreamnt  +downstreamnt
atgccagaggttaaagttccagaattagcagaatctattacagaaggtaccattgcagaa
tggttaaaaaacgttggggatagcgtagaaaaaggtgaagctattcttgaattagaaact
gataaagtaaatgtcgaagtagtatcagaagaagcaggtgtattattcgaacaacttgca
agtgaaggcgacacagtagaagttgggcaagcaattgctgtcattggcgaaggcagtgga
aatgcttcaaatgaatcagaaaaagacaaagataaaactccacaacaaaaagatgaaaca
gagaacaataaagaagaaaaagttacgggcgatgattctacagaatcaaaaacatctgat
gacaatcaacaacgtgttaacgctacaccttctgctcgtcgatatgcgcgtgaaaatggt
gtgaatttagctgaagtaagtccgaaaacaaatgatgtacttcgtaaagaagatatcgat
aaaaagcaagatgcacctgcatcaacaccgacatcacaaaaaacacctgctaaagaagag
aaaaaatacaatcaatatccatcaaagccagttatccgtgaaaaaatgtcacgtagaaag
aaaacagctgctaaaaaattattagaggtatctaataatacagcaatgttaacgacattt
aacgaagttgatatgactaatgtaatggaattacgtaaacgtaagaaagaacagtttatg
aaagatcatgatggtactaaattaggatttatgtcattctttacaaaagcatctgttgca
gcattgaaaaaatatccagaagtcaatgcagaaattgatggggaagatatgattactaaa
cagtattatgacattggcgtagctgtatctactgatgatggcttattagtaccatttgtt
agagactgtgataaaaagaattttgctgaaattgaagcagaaattgcgaatttagcagtg
aaagcaagagagaaaaagcttggtttagatgatatggtaaatggttcatttactattaca
aatggtggtattttcggttcaatgatgagtacgccaattatcaatggaaatcaagcagca
atattaggtatgcactcaatcattacaagaccaattgcgattgatcaagatacaatcgaa
aatcgtccaatgatgtatatcgcattaagctatgatcatagaatcattgacggtaaagaa
gcagttggtttcttaaaaacaattaaagaattgattgaaaacccagaagacttattatta
gaatcataa

DBGET integrated database retrieval system