KEGG   Staphylococcus aureus subsp. aureus MSHR1132: SAMSHR1132_13880Help
Entry
SAMSHR1132_13880  CDS       T01767                                 

Definition
glucokinase (EC:2.7.1.2)
Orthology
K00845  
glucokinase [EC:2.7.1.2]
Organism
suh  Staphylococcus aureus subsp. aureus MSHR1132
Pathway
Glycolysis / Gluconeogenesis
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Streptomycin biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:suh00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    SAMSHR1132_13880
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    SAMSHR1132_13880
   00052 Galactose metabolism
    SAMSHR1132_13880
   00500 Starch and sucrose metabolism
    SAMSHR1132_13880
   00520 Amino sugar and nucleotide sugar metabolism
    SAMSHR1132_13880
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    SAMSHR1132_13880
   00524 Butirosin and neomycin biosynthesis
    SAMSHR1132_13880
Enzymes [BR:suh01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     SAMSHR1132_13880
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1544861..1545847)
Genome map
AA seq 328 aa AA seqDB search
MTKIILAADVGGTTCKLGIFTPELEQLHKWSIHTDTTDSTGYTLLKGIYDSFVEQVDANN
YDFSNVLGVGIGVPGPVDFENGTVNGAVNLYWPGKVNVREIFEQFVECPVFVDNDANIAA
LGEKHKGAGEGADDVVAITLGTGLGGGIISNGEIVHGHNGSGAEIGHFRADFDQRFKCNC
GRSGCIETVASATGVVNLVNFYYPKLTFRSSILELIKENKVTAKAVFDAAKAGDQFCIFI
TEKVANYIGYLCSIISVTSNPKYIVLGGGMSTAGPILIENIKTEYHNLTFKPAQFETEIV
QAKLGNDAGITGAAGLIKTYVLDKEGVK
NT seq 987 nt NT seq  +upstreamnt  +downstreamnt
atgacaaaaattattttagcagctgatgtaggcggaacaacttgtaaattagggattttt
acacctgaattagaacaattacataaatggtcaatccacacagatacaactgatagtaca
gggtatacactattaaaaggtatctatgattcatttgttgaacaagttgatgccaataat
tatgacttttctaacgtgctaggcgtaggaataggtgtgccaggtccagttgactttgaa
aatggcacagttaacggcgcagttaatttatactggccaggaaaagtaaatgtgcgtgaa
atatttgaacagtttgttgagtgtccagtttttgtagataatgacgcaaacattgctgct
ttaggagaaaaacataaaggtgctggtgaaggtgctgatgatgttgtagcaattacactt
ggaacaggtctaggtggaggtatcatttcaaatggtgaaatcgttcatggacataatggt
tctggtgcagaaatcggacattttagagctgattttgatcaacgattcaaatgtaattgt
ggccgttctggctgcattgaaacggttgcatctgctacaggtgttgtcaatttagttaat
ttctactatccaaaattaacttttagatcttcaattttagaattaattaaagagaataaa
gttacggctaaagctgttttcgatgctgctaaagcgggagatcagttctgtatttttata
actgaaaaagtagcaaactatattggatatttatgtagtattattagtgtaactagtaac
cctaaatacattgtacttggcggagggatgtcgacggcaggacctattttaattgaaaat
attaaaacggaatatcataatttaacatttaaaccggcacaatttgaaactgaaatcgta
caagcaaagttaggtaacgatgctggcattactggtgcagcaggtttaattaaaacatat
gtattagataaagagggggtaaaataa

DBGET integrated database retrieval system