KEGG   Staphylococcus argenteus: SAMSHR1132_14780Help
Entry
SAMSHR1132_14780  CDS       T01767                                 

Definition
(GenBank) Holliday junction DNA helicase RuvA (EC:3.6.1.-)
  KO
K03550  
holliday junction DNA helicase RuvA [EC:3.6.4.12]
Organism
suh  Staphylococcus argenteus
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:suh00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    SAMSHR1132_14780
Enzymes [BR:suh01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.12  DNA helicase
     SAMSHR1132_14780
DNA repair and recombination proteins [BR:suh03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   HR (homologous recombination)
    RecBC pathway proteins
     SAMSHR1132_14780
    RecFOR pathway proteins
     SAMSHR1132_14780
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
complement(1638143..1638745)
Genome map
AA seq 200 aa AA seqDB search
MYAYVKGKLTHLYPTHVVVETAGVGYEIQTPNSYRFQKYLDQDVLIHTSLIVREDAQLLY
GFSSEEEKDMFLSLIKVTGIGPKSALAILATSTPNEVKRAIENENDTYLTKFPGIGKKTA
RQIVLDLKGKVKITEEDSDSILQVDPTSTVQDQFVQEAMLALEALGYSKRELTKVEKTLN
KNKYDSVDEAVKAGLQIVVS
NT seq 603 nt NT seq  +upstreamnt  +downstreamnt
atgtacgcgtatgtcaaaggtaagttaacacatttatatccaacacatgtggtagttgaa
actgcaggtgttgggtatgaaattcaaacaccaaattcttatcgttttcaaaagtatcta
gatcaagatgttttaatacatacatctttaatagttcgcgaagatgcccaactattgtat
ggttttagtagcgaagaagaaaaagatatgtttttgagtttaattaaagttactggtata
ggacctaaatctgcattagctattttagcaactagtacacctaacgaggtaaaacgtgct
attgaaaatgaaaatgacacgtatttaactaaattccctggaatcggtaaaaagacagca
agacaaattgtattagatttaaaaggtaaagttaaaattaccgaagaagatagcgattca
atattgcaagtagatccaacctctacagtacaagatcaatttgtacaagaggcaatgtta
gcattagaagcattgggttattctaaacgagaacttacaaaagtagagaaaacgttaaat
aaaaataaatacgactctgttgatgaggctgtaaaagcaggtctacaaatagttgtatct
taa

DBGET integrated database retrieval system