KEGG   Staphylococcus aureus subsp. aureus MSHR1132: SAMSHR1132_14960Help
Entry
SAMSHR1132_14960  CDS       T01767                                 

Definition
delta-aminolevulinic acid dehydratase (EC:4.2.1.24)
Orthology
K01698  
porphobilinogen synthase [EC:4.2.1.24]
Organism
suh  Staphylococcus aureus subsp. aureus MSHR1132
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:suh00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    SAMSHR1132_14960
Enzymes [BR:suh01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.24  porphobilinogen synthase
     SAMSHR1132_14960
Exosome [BR:suh04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   SAMSHR1132_14960
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1654410..1655384)
Genome map
AA seq 324 aa AA seqDB search
MKFDRHRRLRSSASMRNMVRENHVRKEDLIYPIFVVEKDDIKKEIKSLPGVYQISLNLLE
NEIKEAYDLGIRAIMFFGVPNSKDDIGTGAYIQDGVIQQATRIAKKMYDDLLIVADTCLC
EYTDHGHCGVIDDHTHDVDNDKSLPLLVKTAISQVEAGADIIAPSNMMDGFVAEIRQGLD
EAGYYNIPIMSYGVKYASSFFGPFRDAADSAPSFGDRKTYQMDPANRLEALRELESDLKE
GCDMMIVKPALSYLDIVRDVKNHTNIPVVAYNVSGEYSMTKAAAQNGWIDEERVVMEQMV
SMKRAGADMIITYFAKDICRYLDK
NT seq 975 nt NT seq  +upstreamnt  +downstreamnt
atgaaatttgatagacatagaagattaagatcatcagcatcaatgagaaatatggttaga
gaaaatcatgtaagaaaagaagatttaatatatccgatttttgtcgtagaaaaagacgat
attaaaaaagaaattaaatcattacctggtgtgtaccaaatcagtttaaatttacttgaa
aatgaaattaaagaagcatatgacttaggtattcgcgccattatgtttttcggtgttcca
aattcgaaagatgacattggtacaggtgcatatatccaagatggtgtaattcaacaagcg
acacgtatcgctaaaaaaatgtatgacgacttattaattgttgctgacacttgtttatgt
gaatatactgatcacggtcattgtggtgtaattgatgatcatactcatgatgtcgataat
gataaatcgttaccacttcttgttaaaacggcaatttcacaagttgaagcaggtgcagat
atcatcgcaccaagtaatatgatggatggttttgttgctgaaattagacaaggattagat
gaagctggttattataatattccaattatgagttatggcgttaagtatgcttcaagtttc
tttggaccattcagagatgcagcagattctgcgccttcatttggtgatagaaaaacatat
caaatggatcctgccaatagattagaagctttacgtgaattagaaagtgatttaaaagag
ggttgtgacatgatgattgttaaaccggctttgagttacttagatattgttcgagatgtt
aaaaatcatacaaatattccggttgttgcatacaatgtaagtggagagtacagtatgaca
aaagctgcagctcaaaatggttggattgatgaagaacgtgttgttatggaacaaatggtt
tcaatgaaacgtgcaggtgctgatatgattatcacatattttgcaaaagatatttgccgt
tacttagataaatag

DBGET integrated database retrieval system