KEGG   Staphylococcus argenteus: SAMSHR1132_15830Help
Entry
SAMSHR1132_15830  CDS       T01767                                 

Definition
(GenBank) acetyl-coenzyme A synthetase
  KO
K01895  acetyl-CoA synthetase [EC:6.2.1.1]
Organism
suh  Staphylococcus argenteus
Pathway
suh00010  Glycolysis / Gluconeogenesis
suh00620  Pyruvate metabolism
suh00640  Propanoate metabolism
suh00680  Methane metabolism
suh01100  Metabolic pathways
suh01110  Biosynthesis of secondary metabolites
suh01120  Microbial metabolism in diverse environments
suh01130  Biosynthesis of antibiotics
suh01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:suh00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    SAMSHR1132_15830
   00620 Pyruvate metabolism
    SAMSHR1132_15830
   00640 Propanoate metabolism
    SAMSHR1132_15830
  Energy metabolism
   00680 Methane metabolism
    SAMSHR1132_15830
Enzymes [BR:suh01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.1  acetate---CoA ligase
     SAMSHR1132_15830
Lipid biosynthesis proteins [BR:suh01004]
 Acyl-CoA synthetase
  Short/medium chain acyl-CoA synthetase
   SAMSHR1132_15830
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AMP-binding AMP-binding_C
Motif
Other DBs
NCBI-ProteinID: CCE59424
Position
complement(1750251..1751957)
Genome map
AA seq 568 aa AA seqDB search
MKVEVYKGNQGTHNLKDYEETYNNFNWQDVERAFSWNKTGKMNMAYECIDRHVDQGLGDK
IALNYKDEYRKESYSYKEMQRLSNKAANVLSKHASVEKGDRVFIFMSRTPELYFALLGVL
KIGAIVGPLFEAFMEKAVVDRLENSEAKVLITNKSLLSRVPQEKLPHLEKIVVVDDDVEE
DYIDFNTLMKNESDDFDIEWLKHDDGLILHYTSGSTGQPKGVLHVQQAMLLHYISGKYVL
DLQEDDVYWCTADPGWVTGTSYGIFAPWLNGATNCIAGGRFSPEQWYSMIEEFKVTIWYT
APTALRMLMSAGDDIVNKYDLSSLRAILSVGEPLNPEVIKWAKKVYGLTVLDTWWMTETG
GHMIVNYQTMDVKLGSMGKPLPGIEAAIIDDAGNELPPNRMGNLAIKKGWPSMMHRIWKN
PEKYNSYFIGDWYVSGDSAYRDEDGYFWFQGRVDDVIMTAGERVGPFEVESKLVEHEAVA
EAGIIGKPDPVRGEIIKAFVALRKGYEPTDELKEEIRLFVKEGLSAHAAPREIEFKDKLP
KTRSGKIMRRVLKAWELDLDAGDLSTME
NT seq 1707 nt NT seq  +upstreamnt  +downstreamnt
atgaaagtagaagtatacaaaggaaatcaaggaactcataatcttaaagattatgaagaa
acatacaacaactttaactggcaagacgtggaacgtgcattttcttggaataaaactgga
aaaatgaatatggcatatgagtgcattgatcgtcacgttgatcaaggattaggggataaa
attgcgttaaattataaagatgaatatagaaaagaatcttattcatataaggagatgcag
cgtttatcaaataaagctgccaatgttttatctaaacatgcgagtgttgaaaaaggtgac
agagtatttatatttatgtcacgtacacctgaactatattttgcattattaggtgtttta
aaaatcggtgccattgttggtccattatttgaagcttttatggagaaagcagttgtagat
agattagaaaatagtgaagcaaaagtattaataacgaacaaatcattattatcacgagtg
ccacaagaaaaattaccacacctagaaaagattgttgttgttgacgatgatgtcgaagaa
gattacatagactttaatacattaatgaaaaatgaaagtgatgactttgatatagagtgg
ttgaaacatgatgatggtttaattttacattatacatctggttcaactgggcaacctaaa
ggtgttttacatgtacaacaagcgatgttgttacattatatttcaggtaaatatgtattg
gatttacaagaagacgatgtatattggtgtactgctgaccctggatgggttacagggacg
tcatatggtatttttgcgccatggttaaatggtgccacgaattgtattgcaggtggccgt
ttttcaccagaacaatggtatagtatgattgaagagtttaaagtgacaatttggtatact
gctccaacagcattaagaatgttaatgagtgcaggtgatgatattgttaataaatacgac
ttgtcatctttacgtgctattttatctgttggagaaccattgaaccctgaagttattaaa
tgggctaaaaaggtttatggcttaacagtactagatacttggtggatgacagagacaggt
ggacacatgattgtaaattatcaaacaatggacgtcaaacttggatcaatgggcaaacca
ttaccgggtattgaggcagctataattgatgatgcaggcaatgaattgccacctaatcga
atgggtaatcttgctataaaaaaaggatggccatctatgatgcatcgtatttggaaaaat
cctgaaaagtacaattcatattttattggagattggtatgtgtctggagattcagcatat
agagacgaagatgggtatttttggttccaaggccgtgttgacgatgtgatcatgactgca
ggtgaacgtgttgggccatttgaagtagaatcaaaattagttgagcatgaagctgttgca
gaagcgggtatcattggtaagccagaccctgtgcgtggtgaaataattaaggcatttgta
gcgcttagaaaaggttatgaaccaacagatgaattaaaagaggaaattcgattatttgtc
aaagaaggtttgtctgcacatgcagcaccacgggagattgaatttaaagataaattacca
aaaacacgttcaggtaaaattatgagacgcgttttaaaagcatgggaattagatttagat
gcaggtgatttaagtactatggaataa

DBGET integrated database retrieval system