KEGG   Staphylococcus aureus subsp. aureus MSHR1132: SAMSHR1132_18490Help
Entry
SAMSHR1132_18490  CDS       T01767                                 

Definition
succinyl-diaminopimelate desuccinylase (EC:3.5.1.18)
Orthology
K01439  
succinyl-diaminopimelate desuccinylase [EC:3.5.1.18]
Organism
suh  Staphylococcus aureus subsp. aureus MSHR1132
Pathway
Lysine biosynthesis
Metabolic pathways
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:suh00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    SAMSHR1132_18490
  Amino acid metabolism
   00300 Lysine biosynthesis
    SAMSHR1132_18490
Enzymes [BR:suh01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.18  succinyl-diaminopimelate desuccinylase
     SAMSHR1132_18490
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2015903..2017126
Genome map
AA seq 407 aa AA seqDB search
MTTFSEKEKIQLLADIVELQTENNNEIEVCEYLKGLLAKYNIDSKILNVNDQRANIVAEI
GTGSPVLALSGHMDVVDAGNSDNWTYPPFKLTEKEGKLYGRGTTDMKGGLMALVISFIEL
KEQNRLPQGTLRLLATAGEEKEQEGAKLFAKEGYLDDVDGLIIAEPTGSGIFYAHKGSMS
CKVTATGKAVHSSIPFIGDNAIDTLLEFYNQFKEKYTDLKKYDTEHQLDVAPMFKSFIGN
AISEEEANYASGLTAVCSIARGGKQFNSVPDEASLEFNVRPVPEYDNDFVEKFFQDIIND
VNKNKLNLEIPSNHRPVTSDKNSKLVTTLKEIVSNYVNKDDIFIAAHVGATDASSFLGDN
KNNVDLAIFGPGNPIMAHQIDEFIEKDMYLKYIDIYEEAIIKYLKEK
NT seq 1224 nt NT seq  +upstreamnt  +downstreamnt
atgacaacttttagcgagaaggaaaaaattcaattattagcagatattgttgaacttcaa
acagagaataataatgaaattgaagtttgtgaatatttaaaaggtttattagccaaatac
aatatcgactctaaaattttaaatgttaatgatcaaagagctaatatcgttgcagaaatt
ggaactggttctcctgtactagcattgagtggtcatatggacgttgttgatgctggaaat
agtgataactggacataccctccttttaaattgacagaaaaagaaggcaagctatatgga
agaggtacaactgatatgaaaggcggtcttatggctttggtcatatcattcatcgaatta
aaggaacaaaatcgattacctcaaggaacacttcgattgcttgctacagcaggtgaagaa
aaggaacaagaaggtgcaaaattatttgcaaaagaaggatatttagatgatgtagacggt
ttaattattgctgaaccaactggctctggcatattttatgcgcataaaggatcaatgtca
tgtaaagttactgctactggtaaagctgtacatagttcaatcccttttattggagataat
gctatcgacacattgttagaattttataatcagtttaaagaaaaatatacagatcttaaa
aaatatgatacagaacatcaacttgatgtcgcacctatgtttaagtcatttatcggcaat
gctatttctgaagaagaagcaaattatgcttctggacttacggcagtttgttcaattgca
cgcggtggaaaacaatttaattcagtacctgatgaagcgtcactagaatttaatgttaga
cctgttccagaatatgataatgattttgttgaaaagttctttcaagatattattaatgat
gtaaataaaaataaacttaaccttgaaattcctagcaatcatcgacctgtaacaagcgat
aaaaatagtaaattagtaactacgttaaaagaaattgtttctaactatgtgaataaagat
gatatatttatcgctgctcatgtaggtgctacggatgcttccagcttcttaggagataat
aagaataatgtggacttagctattttcggcccaggtaatcctataatggcacatcaaatt
gatgaatttattgaaaaagatatgtatcttaaatatattgatatttatgaagaagcaatc
attaaatatttaaaagaaaaataa

DBGET integrated database retrieval system