KEGG   Staphylococcus argenteus: SAMSHR1132_19960Help
Entry
SAMSHR1132_19960  CDS       T01767                                 

Definition
(GenBank) arginase
  KO
K01476  arginase [EC:3.5.3.1]
Organism
suh  Staphylococcus argenteus
Pathway
suh00220  Arginine biosynthesis
suh00330  Arginine and proline metabolism
suh01100  Metabolic pathways
suh01110  Biosynthesis of secondary metabolites
suh01130  Biosynthesis of antibiotics
suh01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:suh00001]
 Metabolism
  Amino acid metabolism
   00220 Arginine biosynthesis
    SAMSHR1132_19960
   00330 Arginine and proline metabolism
    SAMSHR1132_19960
Enzymes [BR:suh01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.3  In linear amidines
    3.5.3.1  arginase
     SAMSHR1132_19960
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Arginase
Motif
Other DBs
NCBI-ProteinID: CCE59825
Position
complement(2177262..2178170)
Genome map
AA seq 302 aa AA seqDB search
MSKTKAIDIIGVPSTFGQRKLGVDLGPTAIRYAGLIPRMKQLDLEIYDQGDIEVPSLDIE
KFQSEQNGLRNYDEILEVTKNLNKKVSESIENHRFPLVLGGDHSIAVGSVSAISKHYNNL
GVIWYDAHGDLNIPEESPSGNIHGMPLRVLTGEGPKELLEFNVNKVKPENIVLIGMRDLD
KGERQFIKDNDIKTFTMADIDKLGIKEVIENTLTYLKSRNIDGLHLSLDVDALDPLETPG
TGTRVLGGLSYRESHFALELLHQSQLVTSMDLVEVNPLIDHNNHTAEQAVSLIGTFFGET
LL
NT seq 909 nt NT seq  +upstreamnt  +downstreamnt
atgagtaagacaaaggctatagatataattggtgtaccatcaacatttggacaaagaaag
cttggtgttgacttaggtccaactgcaattagatatgcaggattaattccgcgcatgaag
caattggatctagagatttatgatcaaggggatattgaggtaccatcattagatatagaa
aaatttcaaagtgaacaaaatggtttaagaaactatgacgaaattttagaggttacaaag
aacctaaataaaaaagtttcagagtcaattgaaaatcatagattcccgcttgttcttggg
ggagaccattctattgcagttggttctgtctcggcgataagtaaacattataataactta
ggcgtgatttggtatgacgctcatggtgatttgaatattccagaagaatctccaagtgga
aatattcatggaatgcctctacgagttttaacgggtgaaggacctaaagaattattagag
tttaatgtaaataaagtaaaaccagagaatatcgttttaattggtatgagagatttagat
aaaggtgaaagacaatttattaaagataatgacattaaaacttttacaatggctgatata
gataagctaggtataaaagaagttattgaaaatacattaacatatttaaagtcacgtaat
attgatggtttacatttatcattagatgttgatgcactagatcctttagaaacacctggt
acaggaacaagagttttaggaggacttagttatagagaaagtcatttcgcattggagtta
ttacaccaatcacaattagtaacttcaatggatttagttgaagtcaatccactaatcgat
cacaataatcatactgcagagcaggcagtttcattaattggaacattttttggtgaaaca
ttattataa

DBGET integrated database retrieval system