KEGG   Staphylococcus aureus subsp. aureus MSHR1132: SAMSHR1132_21630Help
Entry
SAMSHR1132_21630  CDS       T01767                                 

Definition
putative aldose 1-epimerase
Orthology
K01785  
aldose 1-epimerase [EC:5.1.3.3]
Organism
suh  Staphylococcus aureus subsp. aureus MSHR1132
Pathway
Glycolysis / Gluconeogenesis
Galactose metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Class
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:suh00010]
Metabolism; Carbohydrate metabolism; Galactose metabolism [PATH:suh00052]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2339300..2340319)
Genome map
AA seq 339 aa AA seqDB search
MIVEVEHQRHGVDLIKIDNDETKIIFTNYGARVVSWKYHDNNIVLGNVVEADEFYHNNPF
KFGASIGRYSGRIDNAKFQLNSKEYHLEQNNGVHHLHGGRHGLDNKLFDYEIRNEIAQIK
VIFKTVLKSADDHFPGDVNVTITHIYDADHQWSIEYEAVATEDTLFSPTNHVYFNLNRDN
NVVDNHRISSKQLDMYLLDNRNIVTGEVLDLHEVFEHNKIKLSDIFTSQHPQLSEQMTNF
GGLDHPFTVGEHKMFVENHEFSLEVDTDMPHVVFFTFNQPDEWESSFNIYKPHSGFTLET
QFLPNDINLYGDTAPSILKAGVVFNSTTSFRIQEKVDNE
NT seq 1020 nt NT seq  +upstreamnt  +downstreamnt
atgatagttgaagttgaacatcaaagacatggtgtagatttaatcaaaattgataatgat
gaaactaaaattatttttacgaattatggagcgagagtagtatcttggaaatatcatgat
aataatattgttttggggaatgttgttgaagcagatgaattctatcacaataatccattt
aaatttggtgcttcaattggtagatatagcgggagaattgacaatgctaaattccagttg
aatagtaaagaatatcatttagagcaaaacaacggcgtacatcatttgcatggtggacgt
catggtttggacaataagttgtttgattatgaaattagaaatgaaattgctcaaattaaa
gtgatttttaaaactgtgttgaaatcagcagatgatcatttcccaggtgatgtaaatgta
acgattacacatatttatgatgccgatcatcaatggtctattgaatatgaagcagtagct
acagaagatacgttatttagtccaacaaatcatgtgtattttaatttgaatagagataat
aatgtcgttgataatcatcgtatttctagtaagcagttggatatgtatttattagataac
agaaacattgttactggtgaagttctcgatttacacgaggtatttgaacataataaaatc
aagttaagtgatatttttacgtcgcaacacccacaactaagtgaacagatgacaaatttt
ggtgggttagatcatccatttacagttggtgaacataagatgtttgttgaaaatcatgaa
ttttcattagaagtagatacagatatgccacatgttgtattttttacttttaatcaacct
gatgaatgggaaagttcatttaatatttataaaccacactctggctttacgttggaaaca
caatttttaccaaatgatattaatttatatggtgacacggccccatccattttaaaagct
ggcgtagtatttaattcgacaactagtttccgcatccaagaaaaagttgataatgaataa

DBGET integrated database retrieval system