KEGG   Staphylococcus argenteus: SAMSHR1132_21630Help
Entry
SAMSHR1132_21630  CDS       T01767                                 

Definition
(GenBank) putative aldose 1-epimerase
  KO
K01785  aldose 1-epimerase [EC:5.1.3.3]
Organism
suh  Staphylococcus argenteus
Pathway
suh00010  Glycolysis / Gluconeogenesis
suh00052  Galactose metabolism
suh01100  Metabolic pathways
suh01110  Biosynthesis of secondary metabolites
suh01120  Microbial metabolism in diverse environments
suh01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:suh00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    SAMSHR1132_21630
   00052 Galactose metabolism
    SAMSHR1132_21630
Enzymes [BR:suh01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.3  aldose 1-epimerase
     SAMSHR1132_21630
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldose_epim
Motif
Other DBs
NCBI-ProteinID: CCE59991
UniProt: G7ZRK1
Position
complement(2339300..2340319)
Genome map
AA seq 339 aa AA seqDB search
MIVEVEHQRHGVDLIKIDNDETKIIFTNYGARVVSWKYHDNNIVLGNVVEADEFYHNNPF
KFGASIGRYSGRIDNAKFQLNSKEYHLEQNNGVHHLHGGRHGLDNKLFDYEIRNEIAQIK
VIFKTVLKSADDHFPGDVNVTITHIYDADHQWSIEYEAVATEDTLFSPTNHVYFNLNRDN
NVVDNHRISSKQLDMYLLDNRNIVTGEVLDLHEVFEHNKIKLSDIFTSQHPQLSEQMTNF
GGLDHPFTVGEHKMFVENHEFSLEVDTDMPHVVFFTFNQPDEWESSFNIYKPHSGFTLET
QFLPNDINLYGDTAPSILKAGVVFNSTTSFRIQEKVDNE
NT seq 1020 nt NT seq  +upstreamnt  +downstreamnt
atgatagttgaagttgaacatcaaagacatggtgtagatttaatcaaaattgataatgat
gaaactaaaattatttttacgaattatggagcgagagtagtatcttggaaatatcatgat
aataatattgttttggggaatgttgttgaagcagatgaattctatcacaataatccattt
aaatttggtgcttcaattggtagatatagcgggagaattgacaatgctaaattccagttg
aatagtaaagaatatcatttagagcaaaacaacggcgtacatcatttgcatggtggacgt
catggtttggacaataagttgtttgattatgaaattagaaatgaaattgctcaaattaaa
gtgatttttaaaactgtgttgaaatcagcagatgatcatttcccaggtgatgtaaatgta
acgattacacatatttatgatgccgatcatcaatggtctattgaatatgaagcagtagct
acagaagatacgttatttagtccaacaaatcatgtgtattttaatttgaatagagataat
aatgtcgttgataatcatcgtatttctagtaagcagttggatatgtatttattagataac
agaaacattgttactggtgaagttctcgatttacacgaggtatttgaacataataaaatc
aagttaagtgatatttttacgtcgcaacacccacaactaagtgaacagatgacaaatttt
ggtgggttagatcatccatttacagttggtgaacataagatgtttgttgaaaatcatgaa
ttttcattagaagtagatacagatatgccacatgttgtattttttacttttaatcaacct
gatgaatgggaaagttcatttaatatttataaaccacactctggctttacgttggaaaca
caatttttaccaaatgatattaatttatatggtgacacggccccatccattttaaaagct
ggcgtagtatttaattcgacaactagtttccgcatccaagaaaaagttgataatgaataa

DBGET integrated database retrieval system