KEGG   Staphylococcus aureus subsp. aureus MSHR1132: SAMSHR1132_22450Help
Entry
SAMSHR1132_22450  CDS       T01767                                 

Definition
2,3-bisphosphoglycerate-independent phosphoglycerate mutase (EC:5.4.2.1)
Orthology
K01834  
2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Organism
suh  Staphylococcus aureus subsp. aureus MSHR1132
Pathway
Glycolysis / Gluconeogenesis
Glycine, serine and threonine metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:suh00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    SAMSHR1132_22450
   01230 Biosynthesis of amino acids
    SAMSHR1132_22450
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    SAMSHR1132_22450
  Energy metabolism
   00680 Methane metabolism
    SAMSHR1132_22450
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    SAMSHR1132_22450
Enzymes [BR:suh01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.11  phosphoglycerate mutase (2,3-diphosphoglycerate-dependent)
     SAMSHR1132_22450
Exosome [BR:suh04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   SAMSHR1132_22450
  Exosomal proteins of melanoma cells
   SAMSHR1132_22450
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2423152..2423838)
Genome map
AA seq 228 aa AA seqDB search
MPKLILCRHGQSEWNAKNLFTGWEDVNLSELGINEATRAGEKIRENNIAIDVAFTSLLTR
ALDTTHYILTESKQQWIPVYKSWRLNERHYGGLQGLNKDDARKEFGEEQVHIWRRSYDVK
PPAETEEQREAYLADRRYNHLDKRMMPYSESLKDTLVRVIPFWTDHISQYLLDGQTVLVS
AHGNSIRALIKYLEDVSDEDIINYEIKTGAPLVYELTDDLEVKDKYYL
NT seq 687 nt NT seq  +upstreamnt  +downstreamnt
atgccaaaattaattttatgtcgtcatggacaaagtgaatggaatgctaaaaatttattt
actggatgggaagatgttaatttatcggaactaggtattaatgaagctactagagcagga
gaaaaaataagagaaaataatattgcgattgatgtagcatttacatcattactgacacgt
gctttagatacaacgcattatattttaactgaatctaaacaacaatggattccagtatac
aaaagttggcgcttaaatgaacgtcactatggtgggttgcaaggtttaaataaagatgat
gctaggaaagaattcggtgaagaacaagttcacatttggcgtcgttcttatgatgtgaaa
ccaccagcagaaactgaagaacaacgtgaagcatatttagctgatcgtcgttacaatcat
ttagacaagcgcatgatgccatattcagaaagcttaaaagatactctagtgcgtgtgatt
ccattttggactgatcacatttcacaatatttattagatggtcaaacggtattagtttct
gcacacggaaattctattcgtgcattaattaaatatcttgaagatgtttctgatgaggat
attatcaactatgaaattaaaacaggtgccccgcttgtttatgaattaacagatgactta
gaagttaaagataaatattacttataa

DBGET integrated database retrieval system