KEGG   Staphylococcus argenteus: SAMSHR1132_23200Help
Entry
SAMSHR1132_23200  CDS       T01767                                 

Definition
(GenBank) UTP-glucose-1-phosphate uridylyltransferase
  KO
K00963  UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
suh  Staphylococcus argenteus
Pathway
suh00040  Pentose and glucuronate interconversions
suh00052  Galactose metabolism
suh00500  Starch and sucrose metabolism
suh00520  Amino sugar and nucleotide sugar metabolism
suh01100  Metabolic pathways
suh01130  Biosynthesis of antibiotics
Module
suh_M00549  Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:suh00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    SAMSHR1132_23200
   00052 Galactose metabolism
    SAMSHR1132_23200
   00500 Starch and sucrose metabolism
    SAMSHR1132_23200
   00520 Amino sugar and nucleotide sugar metabolism
    SAMSHR1132_23200
Enzymes [BR:suh01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     SAMSHR1132_23200
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: NTP_transferase NTP_transf_3 IspD Glycos_transf_2 ATP-gua_PtransN
Motif
Other DBs
NCBI-ProteinID: CCE60147
Position
complement(2513132..2513998)
Genome map
AA seq 288 aa AA seqDB search
MKKIKKAIIPAAGLGTRFLPATKAMPKEMLPILDKPTIQYIVEEAARAGIEDIIIVTGRH
KRAIEDHFDSQKELEMVLKEKGKSELLEKVQYSTELANIFYVRQKEQKGLGHAISSARQF
IGNEPFAVLLGDDIVESEVPAVKQLIDVYEETGHSVIGVQEVPEADTHRYGIIDPLTKNG
RQYEVKKFVEKPAQGTAPSNLAIMGRYVLTPEIFDYLKTQKEGAGNEIQLTDAIERMNND
NQVYAYDFEGERYDVGEKLGFVKTTIEFALKDNSMKEELTRFIKELGL
NT seq 867 nt NT seq  +upstreamnt  +downstreamnt
ttgaaaaaaataaaaaaggcaatcattcccgctgctggtttagggactagatttttacca
gcaactaaagcgatgccaaaggaaatgcttcctatcttagataaacccacaatccagtat
attgttgaagaagctgcacgagctggaattgaagatattattatagtgacgggtcgccat
aaacgcgcgattgaagatcattttgatagtcaaaaagaattagaaatggttttaaaagaa
aaagggaaatctgagttactagaaaaagttcaatattctactgaacttgcgaatattttt
tatgtaaggcagaaagaacaaaaaggtttagggcatgccataagttcggcgcgtcaattt
atcggcaatgaaccatttgcggtgttgctgggtgacgatattgttgaatctgaagtgcca
gcagtgaaacagttgattgacgtttatgaagaaactgggcactcagttataggtgtccaa
gaagttccggaagcagatactcatcgttatggaattattgatccattaactaaaaatgga
cgtcagtatgaagtgaaaaagtttgttgaaaagccagcacaaggtacggcaccatcaaac
ctagctattatggggcgatatgtattaacgcctgaaattttcgattatttaaaaacgcaa
aaagaaggcgcaggtaacgaaattcagttaacagatgcgattgagcgcatgaataatgat
aatcaggtgtatgcttatgacttcgaaggcgaacgttatgatgttggagaaaaattaggc
tttgtcaaaacaacaatagaattcgcattaaaagataacagtatgaaagaagaactcaca
cgatttattaaagaattaggtttataa

DBGET integrated database retrieval system