KEGG   Staphylococcus argenteus: SAMSHR1132_23370Help
Entry
SAMSHR1132_23370  CDS       T01767                                 

Definition
(GenBank) fructose-1,6-bisphosphatase class 3
  KO
K04041  fructose-1,6-bisphosphatase III [EC:3.1.3.11]
Organism
suh  Staphylococcus argenteus
Pathway
suh00010  Glycolysis / Gluconeogenesis
suh00030  Pentose phosphate pathway
suh00051  Fructose and mannose metabolism
suh00680  Methane metabolism
suh01100  Metabolic pathways
suh01110  Biosynthesis of secondary metabolites
suh01120  Microbial metabolism in diverse environments
suh01130  Biosynthesis of antibiotics
suh01200  Carbon metabolism
Module
suh_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:suh00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    SAMSHR1132_23370
   00030 Pentose phosphate pathway
    SAMSHR1132_23370
   00051 Fructose and mannose metabolism
    SAMSHR1132_23370
  Energy metabolism
   00680 Methane metabolism
    SAMSHR1132_23370
Enzymes [BR:suh01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.11  fructose-bisphosphatase
     SAMSHR1132_23370
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FBPase_2 GP24_25
Motif
Other DBs
NCBI-ProteinID: CCE60164
Position
2536735..2538699
Genome map
AA seq 654 aa AA seqDB search
MTQITEKELKKKYLDLLSQHFDSPEKLATEIINLESILELPKGTEHFVSDLHGEYEAFQH
VLRNGSGNVRAKINDIFKEKLSTKELNDLTALVYYPEDKLKLIKSDFQSCGQLNVWYITT
IEHLIELIKYCSSKYTRSKLRKALPKQYVYIIEELLYKSNEYQNKKSYYETLVNQVIELK
QADDLIIGLAYSVQRLVVDHLHVVGDIYDRGPQPDKIMDTLINYHSLDIQWGNHDVLWVG
AYAGSKVCLANLLRICARYDNLDIIEDAYGINLRPLLTLAEKYYDADNPAFKPKKRPDKH
ERLTQREESQITKIHQAIAMIQFKLEIPIIKRRPNFEMEERLVLEKVNYDTNEITVYGNT
YPLKDTCFQTVNRDNPAELLPEEEEVMNKLLLSFQQSEKLRRHMSFLMRKGTLYLPYNGN
LLIHGCIPVDEQGKMESFEIDGKTYNGQELLDVFEYHVRKSFDHKDQTDDLSTDLVWYLW
TGKYSSLFGKRAMTTFERYFIADKASHKEEKNPYYHLREDVNMVRKMLSDFGLNPDEGRI
INGHTPVKEINGEDPIKADGKMLVIDGGFSKAYQSTTGIAGYTLLYNSFGMQLVAHQQFN
AKEKILSEGIDELSIKRVVDKELQRKKIRDTNIGKELQDQIDILKILMHDRYLD
NT seq 1965 nt NT seq  +upstreamnt  +downstreamnt
atgactcaaattactgaaaaagaattaaaaaagaagtatttagatttgctatctcaacat
tttgattctccagaaaagcttgcaactgaaattatcaatttggaatctattttagaatta
cctaaaggtaccgagcatttcgtcagcgatttacatggtgaatatgaagcatttcaacac
gtattacgcaacggttctgggaatgtacgagcgaaaatcaatgatatttttaaagaaaag
ctttcaacaaaggagctcaatgacttaacagctctcgtatactatccagaagataaatta
aagctgattaaaagtgattttcaaagttgtggccaacttaatgtctggtatatcacaacg
attgaacatttaattgaattgattaaatactgctcttcaaaatatactcgttctaaacta
cgtaaagcattgccaaagcaatatgtttatatcatcgaagaactactatataaaagtaac
gaatatcaaaataaaaaatcttactatgagacgcttgttaaccaagtgattgaacttaaa
caagctgatgatttaattataggtcttgcgtattctgtacaacgcttagttgttgatcat
ttacacgttgtcggtgacatttatgatcgtggcccgcaaccagataaaatcatggatacg
ctgattaattatcattctctagatattcaatggggaaatcatgatgtgctttgggttggt
gcttatgcaggatctaaagtatgcttagcaaatttacttcgaatttgtgcacgttatgat
aatttagatattatcgaagacgcttatggcataaatttaagaccactgcttactttagct
gaaaaatactatgatgcagataatcctgcttttaaacctaaaaaaagacccgataaacat
gaacgtttaactcaacgtgaagaaagtcagattactaaaattcatcaagcaattgcgatg
attcaattcaagttagaaataccaattattaaacgtcgtccaaatttcgaaatggaagaa
cgtcttgtgcttgaaaaagttaattatgatactaatgaaattacggtttatggtaataca
tacccattgaaagatacatgtttccaaactgtcaatcgtgataatcctgcagaattacta
cctgaagaagaagaagtcatgaataaactattattatctttccaacaatctgaaaaatta
cgtcgtcatatgtcatttttaatgcgtaaaggtacgctttacttaccatacaatggaaat
ttactcattcatggatgtattccagttgatgaacaaggtaagatggaatcatttgaaatt
gacggaaaaacttataatggtcaagaattattagacgtctttgagtatcatgtgcgtaaa
tcatttgaccataaagatcaaactgacgatttatcgacggatttagtttggtatttatgg
actgggaaatattcttcattatttggtaagcgtgccatgacaacgtttgagcgatacttt
attgcggataaagcttctcacaaggaagaaaaaaatccatactatcatcttcgtgaagat
gtgaatatggttcgtaaaatgctcagtgatttcggattaaatccagatgaaggtcgcatt
attaatggtcacacaccagtgaaagaaattaatggcgaagatcctatcaaggctgatgga
aagatgcttgtcattgatggcggcttttcaaaggcgtatcagtcaacaactggcattgca
ggatatacattgttgtacaattcattcggaatgcaactcgttgcacatcaacaatttaac
gctaaagaaaaaatcctttccgaaggtattgatgaactttctataaagcgcgtcgtagat
aaagaattacaacgtaagaagattcgtgatactaatattggaaaagagttacaagatcaa
atcgatattttaaaaatattaatgcatgatcgttatttagactaa

DBGET integrated database retrieval system