KEGG   Streptococcus suis JS14: SSUJS14_0058Help
Entry
SSUJS14_0058      CDS       T02024                                 

Gene name
ruvA
Definition
Holliday junction DNA helicase RuvA
Orthology
K03550  
holliday junction DNA helicase RuvA [EC:3.6.4.12]
Organism
sui  Streptococcus suis JS14
Pathway
Homologous recombination
Class
Genetic Information Processing; Replication and repair; Homologous recombination [PATH:sui03440]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
64530..65120
Genome map
AA seq 196 aa AA seqDB search
MYDYIKGILTKITAKYIVVETQGVGYILQVANPYAYSGQVQQEVTVYTHQVIREDAHLLY
GFATENEKSVFLSLISVSGIGPTTALAIIAVDDNDGLVRAIEQKNITYLTKFPKIGKKTA
QQMILDLEGKFVMSEEAGPVQQVAPSSENIALEEAMEAMEALGYRPAELKKIKKFFEGTN
DTAENYIKSALKMLMK
NT seq 591 nt NT seq  +upstreamnt  +downstreamnt
atgtacgactatattaaaggaattttaacaaaaataactgcaaaatacattgtggtagaa
acgcaaggagtaggctatatcttgcaggttgctaatccctacgcctattcaggacaagtc
cagcaagaagtgactgtctatactcatcaggtgattcgtgaagatgctcatttgctctac
ggatttgctacagaaaatgaaaaatccgtctttctgagtctgatttcagtatcaggtatt
ggtccaacaacagctctggctattattgctgttgatgataatgatggacttgttcgtgct
atcgagcagaaaaacattacctacctgaccaaatttccaaagattggcaagaaaacagcc
cagcagatgattttggacttggaaggcaagtttgtcatgagcgaagaagcgggtcctgtt
caacaagtagcaccatccagtgaaaatatcgcccttgaagaagccatggaagccatggaa
gcccttggttaccgcccagccgaactcaagaaaatcaagaaattctttgaaggcaccaac
gacaccgcagaaaactacatcaagtcagcccttaaaatgctgatgaagtaa

DBGET integrated database retrieval system