KEGG   Streptococcus suis JS14: SSUJS14_0416Help
Entry
SSUJS14_0416      CDS       T02024                                 

Definition
beta-galactosidase
Orthology
K12308  
beta-galactosidase [EC:3.2.1.23]
Organism
sui  Streptococcus suis JS14
Pathway
Galactose metabolism
Brite
KEGG Orthology (KO) [BR:sui00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    SSUJS14_0416
Enzymes [BR:sui01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.23  beta-galactosidase
     SSUJS14_0416
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
434001..435773
Genome map
AA seq 590 aa AA seqDB search
MKEFYIGDQFYLDGEPFKILSGAIHYFRVHPDDWYHSLYNLKALGFNTVETYVPWNMHEP
RKGEFCYEGILDIERFLKLAQELGLYAIVRPSPYICAEWEWGGLPAWLMKEELRVRSSDS
VYLQHLDEYYVSLIPKLAKLQLAQGGNVLMFQVENEYGSYGEEKAYLRAVAGLMRKHGLT
APLFTSDGSWRATLRAGTLIEDDVFVTGNFGSKARENFANMTAFFNEHQKNWPLMCMEFW
DGWFNRWGDEIIRREPEEMVDSVMECIELGSLNLYMFHGGTNFGFMNGCSARGQIDLPQV
TSYDYDAILDEAGNPTKKFYILQQRLKEVYPELEYAEPLVKEAKAFSDVSLHDKVSLFAT
LENVSDCVKGFYPKNMEELDQSTGYILYRTELERDKTEAERFRVVDARDRIQIYADGKFV
ATQYQTEIGDDVELDFKDDKLTLDILVENMGRVNYGHKLTAPTQSKGIGRGAMADLHFIG
HWETYPLHLESVEDLDFSKGWEEGQAAFYRYQFELDELADTYLDMTGFGKGVVFVNNVNI
GRFWEKGPILYLYIPKGYLKKGANEIVVFETEGKYREKIHFSQRPVIKDL
NT seq 1773 nt NT seq  +upstreamnt  +downstreamnt
atgaaagaattttatattggagaccaattttatttggacggtgaaccctttaagatttta
tcaggcgcgattcattattttcgtgtccatcctgatgattggtaccattctttgtataac
ttaaaggcccttggttttaatacggttgaaacctatgtcccttggaatatgcatgagcct
cgaaagggtgagttttgttacgagggtatattggatattgagcgatttttgaaattggct
caagaattagggctttatgcaattgtacgaccgtccccctatatttgtgctgagtgggaa
tggggtggcctccctgcttggttgatgaaggaagagcttagagtacgttcgagtgattcg
gtgtacttgcagcacttagatgaatattacgtttctcttattcctaaattggccaagctc
caactcgcacagggtggaaatgtacttatgttccaagtggaaaatgagtatggatcttat
ggtgaggagaaggcatatttaagagcggtggctggcttgatgcgtaaacatggtctaact
gctcccttgtttacctcggacggttcttggcgagcaacattacgtgcaggaacactgata
gaggacgatgtatttgtaacaggaaactttggttctaaagctagagagaattttgcaaat
atgacggcattctttaatgaacatcagaagaattggccactcatgtgtatggaattttgg
gatggttggttcaatcgttggggcgatgaaattattcgtagagagccggaggaaatggtt
gattcagttatggaatgtatcgaattgggctccttgaatctgtacatgttccatggtgga
acaaattttggtttcatgaatggttgctctgctcgtggtcaaattgatttgcctcaggta
acttcttatgattatgatgctatattggatgaagctggaaatcctactaagaagttttat
attttgcaacaacgtttgaaagaagtctatcctgaattagagtatgcagaaccgcttgta
aaagaggcaaaagctttttcagatgtgtcgcttcatgataaggtgagtctgtttgctact
ctagaaaatgtaagcgattgcgtaaaagggttttatcctaagaatatggaagaacttgat
cagtcaacaggttatattttatatagaacagagttggagcgggataagacagaagcagaa
cgtttccgagtggttgatgcgcgtgaccgtatccaaatttatgcagatggaaaattcgtt
gcaactcagtatcagactgagattggtgacgatgttgaattggattttaaagatgacaag
ctaacattagatattttggtagaaaatatgggacgtgtcaattatgggcacaaactaacg
gctcctacccagtctaaagggattggtcgaggtgcgatggctgatttacattttattggt
cattgggaaacctatcctttgcatcttgagtcagttgaggacctggattttagtaagggc
tgggaggaaggtcaagctgctttctatcgttatcagtttgaactggatgaacttgcggat
acttacttagacatgacaggttttggtaagggagttgttttcgttaataatgtaaatatt
ggacgtttttgggaaaaaggaccaatcctctatctctatattccaaaaggatacttaaag
aaaggagcgaatgaaatagttgtcttcgagacagaaggaaaatatagagagaagattcat
ttttcacaaagacccgttataaaagacttgtag

DBGET integrated database retrieval system