KEGG   Streptococcus suis JS14: SSUJS14_0495Help
Entry
SSUJS14_0495      CDS       T02024                                 

Gene name
tpiA
Definition
(GenBank) triosephosphate isomerase
  KO
K01803  triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
sui  Streptococcus suis JS14
Pathway
sui00010  Glycolysis / Gluconeogenesis
sui00051  Fructose and mannose metabolism
sui00562  Inositol phosphate metabolism
sui01100  Metabolic pathways
sui01110  Biosynthesis of secondary metabolites
sui01120  Microbial metabolism in diverse environments
sui01130  Biosynthesis of antibiotics
sui01200  Carbon metabolism
sui01230  Biosynthesis of amino acids
Module
sui_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
sui_M00002  Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:sui00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    SSUJS14_0495 (tpiA)
   00051 Fructose and mannose metabolism
    SSUJS14_0495 (tpiA)
   00562 Inositol phosphate metabolism
    SSUJS14_0495 (tpiA)
Enzymes [BR:sui01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     SSUJS14_0495 (tpiA)
Exosome [BR:sui04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   SSUJS14_0495 (tpiA)
  Exosomal proteins of bladder cancer cells
   SSUJS14_0495 (tpiA)
  Exosomal proteins of melanoma cells
   SSUJS14_0495 (tpiA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TIM
Motif
Other DBs
NCBI-ProteinID: ADV69596
Position
516776..517528
Genome map
AA seq 250 aa AA seqDB search
MSRKPIIAGNWKMNKNPQEAQAFVEAIAGKLPAGDKIEAAIAAPAVDLNALLWFAKDSEL
KVAAQNCYFEDAGAFTGETSPKVLAEMGVNYVVIGHSERRDYFHETDEDINKKAHAIFRN
GLTPIICCGESLETYEAGKAVEFVGAQVSAALKDLTADQVASLVIAYEPIWAIGTGKSAT
KDDAQNMCKAVRDVVAADFGQEVADKVRVQYGGSVNPSNVAEYMACPDVDGALVGGASLE
AESFLALLNF
NT seq 753 nt NT seq  +upstreamnt  +downstreamnt
atgtcacgtaaaccaatcattgccggtaactggaaaatgaacaaaaatcctcaagaagca
caagctttcgttgaggcaattgcaggaaaattgcctgcaggcgacaaaattgaagcagct
atcgcagctccagctgtagatttgaacgctctcttatggttcgctaaagattctgaattg
aaagttgctgctcaaaactgctactttgaagatgctggtgccttcactggtgaaacatct
ccaaaagtattggctgaaatgggtgttaactatgttgttatcggtcactcagagcgtcgt
gattacttccacgaaactgatgaagatattaataaaaaagctcatgcaatcttccgtaac
ggtttgactccaatcatctgttgtggtgagtcacttgaaacttacgaagctggtaaagca
gtagaatttgtaggtgctcaagtttctgcagctttgaaagacttgactgctgatcaagta
gcatcacttgttattgcttatgagccaatctgggcaatcggtactggtaaatcagctact
aaagatgatgcacaaaacatgtgtaaagctgttcgtgacgttgttgctgctgatttcggt
caagaagttgcagacaaagttcgcgttcaatacggtggttctgtaaacccatcaaacgtt
gctgaatacatggcatgtccagacgttgacggtgcgcttgttggtggtgcatcacttgaa
gcagaaagcttcttggctttgttgaacttctaa

DBGET integrated database retrieval system