KEGG   Streptococcus suis JS14: SSUJS14_0506Help
Entry
SSUJS14_0506      CDS       T02024                                 

Definition
6-phosphofructokinase
Orthology
K00850  
6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
sui  Streptococcus suis JS14
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Class
Metabolism; Overview; Carbon metabolism [PATH:sui01200]
Metabolism; Overview; Biosynthesis of amino acids [PATH:sui01230]
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:sui00010]
Metabolism; Carbohydrate metabolism; Pentose phosphate pathway [PATH:sui00030]
Metabolism; Carbohydrate metabolism; Fructose and mannose metabolism [PATH:sui00051]
Metabolism; Carbohydrate metabolism; Galactose metabolism [PATH:sui00052]
Metabolism; Energy metabolism; Methane metabolism [PATH:sui00680]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
528980..529990
Genome map
AA seq 336 aa AA seqDB search
MKRIAVLTSGGDAPGMNAAIRAVVRQAISEGMEVYGINEGYAGMVAGDIHELSARSVGDI
ISRGGTFLCSARYPEFAKLEGQLKGIEQLKKHGIEGVVVIGGDGSYHGAMRLTEHGFPAI
GVPGTIDNDIVGTDFTIGFDTAVTTAMDAIDKIRDTSSSHRRTFVVEVMGRHAGDIALWA
GIASGADVIVVPEEDFNINDVVDRIKAGYDKGKKHSIIVLAEGVMPAAQFAEELKAAGDT
SDLRVTELGHIQRGGSPTARDRVLASRMGAHAVKLLKEGRGGLAVGIRNEQMVENPILGT
AEEGALFSLTTDGKIVVNNPHKADLELADLNRNLSI
NT seq 1011 nt NT seq  +upstreamnt  +downstreamnt
atgaaacgtattgctgttttgaccagtggtggtgatgcccctggtatgaacgctgctatt
cgtgcagttgttcgccaagcaatttcagaaggaatggaagtttatggaatcaacgaaggt
tacgcaggtatggttgcgggtgatatccatgaattgtctgcacgttctgtaggtgatatt
atttcacgtggaggaacattcctttgttcagctcgttatccagaatttgccaaattagaa
gggcaacttaaagggattgagcaattgaaaaaacatggtatcgaaggtgtagttgttatc
ggtggtgatggttcttaccacggtgcaatgcgcttgacggagcatggtttcccagctatt
ggtgtacctggtacaattgataacgacatcgtgggtacagattttacaatcggttttgat
acagctgtaacaactgctatggatgcgattgataaaatccgcgatacttcatcaagtcac
cgtcgtactttcgttgttgaagtaatgggacgtcatgcgggagacatcgctctttgggct
ggtattgcttctggtgcagatgttatcgttgttccagaagaagacttcaatatcaacgat
gttgttgatcgcattaaagcgggctacgataaaggtaagaaacatagcatcattgtcttg
gccgaaggtgttatgccagcggcacagtttgctgaagaattgaaagcagcaggcgataca
agtgatcttcgtgtgacagaacttggtcatatccaacgtggtggttctccaacagcgcgt
gatcgtgtactcgcttctcgtatgggtgctcatgccgttaaattgcttaaagaaggccgt
ggaggtcttgcggtaggtatccgtaacgagcaaatggttgaaaatccaattcttggaact
gcagaagaaggtgccttgtttagcttgactactgatggcaagattgtagttaataatccg
cataaagcagatttggagttggctgatttgaaccgtaacttgtcaatctag

DBGET integrated database retrieval system