KEGG   Streptococcus suis JS14: SSUJS14_0736Help
Entry
SSUJS14_0736      CDS       T02024                                 

Definition
putative glutathione peroxidase
Orthology
K00432  
glutathione peroxidase [EC:1.11.1.9]
Organism
sui  Streptococcus suis JS14
Pathway
Glutathione metabolism
Arachidonic acid metabolism
Brite
KEGG Orthology (KO) [BR:sui00001]
 Metabolism
  Lipid metabolism
   00590 Arachidonic acid metabolism
    SSUJS14_0736
  Metabolism of other amino acids
   00480 Glutathione metabolism
    SSUJS14_0736
Enzymes [BR:sui01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.9  glutathione peroxidase
     SSUJS14_0736
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
751485..751964
Genome map
AA seq 159 aa AA seqDB search
MSIYDFTVQKQDGTDQSMAEYQGQVLLIVNTAPGCGLAPQYKELQELYDSYKDNGFVVLD
FPCNQFLNQAPGSAEDINQICSLNYGTTFPRFAKIAVNGSEASPLYRYLKKEKSTLLGGR
IEWNFTKFLVDRQGRVVKRYLPTTSPLKLKEDIELYLEK
NT seq 480 nt NT seq  +upstreamnt  +downstreamnt
atgagcatttatgattttacagtacaaaaacaagatggcacagaccagtccatggctgag
tatcaaggacaagttttacttatagtcaatacagcgccaggttgtggattggcaccacaa
tacaaggaactacaggagctatatgatagctataaagacaacggttttgtagtgttggat
ttcccttgtaatcaatttttaaatcaggctcccggttctgcggaagacatcaatcagatc
tgtagcttgaattatggtacaacttttcctcgttttgctaaaattgctgtgaatggatct
gaagctagtccgctatatcgctatcttaagaaagaaaaatcaaccttattaggaggtcga
attgagtggaattttaccaagtttttggtggatagacaagggcgtgtggtcaaacgatat
ttaccaacaactagtccattaaaacttaaagaggatattgaactttacctagaaaaataa

DBGET integrated database retrieval system