KEGG   Streptococcus suis JS14: SSUJS14_0810Help
Entry
SSUJS14_0810      CDS       T02024                                 

Gene name
glpK
Definition
glycerol kinase
Orthology
K00864  
glycerol kinase [EC:2.7.1.30]
Organism
sui  Streptococcus suis JS14
Pathway
Glycerolipid metabolism
Metabolic pathways
Class
Metabolism; Lipid metabolism; Glycerolipid metabolism [PATH:sui00561]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
823868..825382
Genome map
AA seq 504 aa AA seqDB search
MSTEKYIMAIDQGTTSSRAIIFNKKGEKVGSYQKEFTQIFPKPGWVEHNANEIWNSVQSV
IAGSFIESGVRPDQIEGIGITNQRETTVVWDKETGLPIYNAVVWQSRQTAHIADQLKADG
HADMIHQKTGLVVDAYFSATKVRWILDQVPGAQERAEKGEILFGTIDTWLVWKLTDGKCH
VTDYSNAARTMLYNIEELKWDDEILSLLNIPKAMLPEVRSNSEVYGTTAPFHFYGAEVPI
SGMAGDQQAALFGQLAFEPGMVKNTYGTGSFIVMNTGEEMQLSQNNLLTTIGYGIGGKVY
YALEGSIFIAGSAVQWLRDSMRMVTTSPESEELARKSTSNDEVYVVPAFTGLGAPYWNSD
ARGSVFGLTRGTTKEDFVKATLQSIAYQVRDVIDTMQLDTGIDISVLKVDGGAAMNSLLM
QFQADILGIEIARAQNLETTALGAAFLAGLAVGFWKDLDELKELNAVGQSFQPTMNEARK
EQLYKGWKKAVAATQLFAEVDEEQ
NT seq 1515 nt NT seq  +upstreamnt  +downstreamnt
atgtctactgaaaaatatatcatggccattgaccaaggaactacaagttcacgtgccatt
atcttcaataaaaaaggtgaaaaggttggcagttaccaaaaagagtttacgcaaattttc
cctaaaccaggttgggttgaacacaacgccaatgaaatttggaattctgttcagtctgtg
attgcagggtcctttatcgaaagcggtgttcgtcctgatcagattgaaggaattggtatt
accaaccagcgtgaaacaaccgttgtctgggataaggaaacaggtcttccaatctacaat
gccgttgtctggcaatctcgtcaaacagctcatattgctgaccagctgaaggcggatggt
catgcagatatgattcatcaaaagacaggtctagtagtcgacgcctacttctcagcaacc
aaagttcgttggattttagatcaagtccctggagcgcaggaacgtgctgaaaaaggtgag
attctctttggaaccattgatacttggttggtttggaaattgactgatgggaaatgccat
gtgacggattattcaaacgcagctcgtaccatgctctacaacattgaagagttgaaatgg
gatgatgaaattttatctcttctcaatattccaaaagccatgctgccagaagttcgttca
aactctgaagtttacggcacaacagctccattccatttctatggcgcagaagtgccaatc
tctggcatggcaggtgaccaacaggctgccttatttggacaattagcatttgagccaggt
atggtgaaaaatacttacggaaccggttccttcatcgtgatgaatacaggtgaagagatg
cagttgtcacagaacaaccttctcacaacaattggctatggtatcggtggcaaagtctat
tatgcgcttgaaggatctatctttatcgctggttcggcggttcaatggctccgtgacagc
atgcgaatggtgactacatcacctgagtcagaagagcttgctcgtaagtctaccagcaat
gatgaagtctatgttgttccagcctttacaggacttggtgctccgtattggaactcagat
gcgcgtggctcagtctttggtctcactcgtggtacgactaaagaagacttcgtcaaagca
actcttcaatccattgcctaccaagttcgagatgttattgacaccatgcaattggataca
ggtattgatatttctgtcttgaaggttgacggtggtgcagcaatgaacagcctcctcatg
caattccaagcagatattttgggtattgaaatcgcacgcgctcaaaaccttgaaactaca
gctcttggagcagcattcttagcaggtttagcagttggtttctggaaagatttggatgaa
ttgaaagaactcaacgctgtcggccaatccttccaaccaaccatgaacgaagctcgtaaa
gaacaactttacaagggatggaaaaaagctgtcgcagcaactcaactatttgcagaagtg
gatgaagagcaataa

DBGET integrated database retrieval system