KEGG   Streptococcus suis JS14: SSUJS14_0914Help
Entry
SSUJS14_0914      CDS       T02024                                 

Definition
transcriptional regulator/sugar kinase
Orthology
K00845  
glucokinase [EC:2.7.1.2]
Organism
sui  Streptococcus suis JS14
Pathway
Glycolysis / Gluconeogenesis
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Streptomycin biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:sui00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    SSUJS14_0914
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    SSUJS14_0914
   00052 Galactose metabolism
    SSUJS14_0914
   00500 Starch and sucrose metabolism
    SSUJS14_0914
   00520 Amino sugar and nucleotide sugar metabolism
    SSUJS14_0914
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    SSUJS14_0914
   00524 Butirosin and neomycin biosynthesis
    SSUJS14_0914
Enzymes [BR:sui01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     SSUJS14_0914
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
934051..935010
Genome map
AA seq 319 aa AA seqDB search
MSKKIIGIDLGGTSVKLAILTTEGEIQEKWSIKTNILDDGSHIVPDIIDSIKQRFETHGL
TKDDFLGIGMGSPGVVDSEAGTVIGAYNLNWKTLQLVKEQFESALGLPFFIDNDANVAAL
GEQWVGAGNNNPNVVFMTLGTGVGGGVIAAGNLIRGVKGAGGELGHITVDFDEPFACTCG
KKGCLETVASATGIVNLSRRYADQYAGDAKLKQMIDDGQDVTAKDVFDLAKEGDDLALIV
YRHFSEYLGVACANIAAVLNPAYIVLGGGVSAAGEFLLDGVRKVFAENSFPQIKESTQIV
LATRGNDAGVLGAASLVLK
NT seq 960 nt NT seq  +upstreamnt  +downstreamnt
atgtctaaaaaaattatcggtattgaccttgggggaacttctgttaaattggccattttg
actactgagggagaaattcaagaaaaatggtctatcaagacaaatattttagatgatgga
agtcatattgttcctgatattattgacagtatcaagcagcgatttgaaacccatggtttg
acaaaggacgatttcttaggaattggtatgggctcacccggtgtagtggatagtgaagct
ggcactgttatcggagcctataacctcaactggaagaccttgcaattggtcaaagagcag
tttgaatctgcgctcggtttaccattctttattgacaatgatgcaaacgtagcggccctc
ggtgaacaatgggttggtgctggaaacaacaatccaaacgttgtctttatgacgcttggt
acaggtgtcggtggcggtgtcatcgctgctggaaacttgattcgtggtgtcaaaggtgct
ggtggcgaattgggccatatcacagttgactttgatgagccatttgcatgtacttgtggt
aagaaaggttgtctagaaacagttgcttcagcgacaggtattgtcaacctcagccgtcgc
tatgctgatcaatacgcaggcgatgcaaaactgaaacaaatgattgatgatgggcaagat
gtaacggctaaagatgtctttgatttggcaaaagagggcgatgatttggctttgattgtc
taccgtcacttctcagaatacttaggtgttgcttgtgcaaacattgctgcagtcctcaat
cctgcctacatcgttcttggtggtggtgtatcagctgcgggagagttcttattggatggc
gttcgcaaggtctttgctgaaaatagcttcccacaaatcaaggaaagtacacaaattgtc
ttggcaacacgtggtaatgatgcaggtgtattgggcgcagcatcactcgtcttgaaataa

DBGET integrated database retrieval system