KEGG   Streptococcus suis JS14: SSUJS14_1116Help
Entry
SSUJS14_1116      CDS       T02024                                 

Gene name
folE
Definition
GTP cyclohydrolase I
Orthology
K01495  
GTP cyclohydrolase I [EC:3.5.4.16]
Organism
sui  Streptococcus suis JS14
Pathway
Folate biosynthesis
Metabolic pathways
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:sui00790]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1115763..1116326)
Genome map
AA seq 187 aa AA seqDB search
MSKQEQIEQTIYQLLELLGEDPNREGLLDTPKRVAKMYLEMFNGLEEDPKDQFTAVFSEG
HEEVVLVKDIPFHSMCEHHLVPFYGIAHVAYIPSKGRVTGLSKLARAVEVASRRPQLQER
LTHQVAHALQDALEPEGVFVMVEAEHMCMSMRGIRKPGSKTVTTVALGKYKEDAILRREL
LSMIHNK
NT seq 564 nt NT seq  +upstreamnt  +downstreamnt
atgtcaaaacaagaacaaatcgaacaaacaatttatcaattattggaattattgggtgag
gacccgaatcgtgaaggtttattagatacgcctaaacgggttgctaagatgtatttagaa
atgtttaacggcctagaagaggatcccaaagaccaatttacagctgtcttttcagaaggt
catgaagaggttgttttggtcaaggatattccttttcattctatgtgtgaacaccatttg
gtacccttttatggcattgcccatgtagcttatattccgagtaaggggcgtgtgacaggt
cttagcaaattggcgcgtgcagtggaggtagcaagtcgtcgccctcaattgcaggaacgc
ttgacccatcaggttgcccatgcccttcaagatgcccttgaaccagaaggtgtttttgtc
atggtcgaagcagagcacatgtgcatgagcatgcgtggtattcgcaagccaggtagtaag
acagtgaccacagttgctcttggcaaatacaaggaagatgccatcttgcgccgtgaactc
ttgtccatgattcacaataaatag

DBGET integrated database retrieval system