KEGG   Streptococcus suis JS14: SSUJS14_1262Help
Entry
SSUJS14_1262      CDS       T02024                                 

Definition
dTDP-4-dehydrorhamnose 3,5-epimerase
Orthology
K01790  
dTDP-4-dehydrorhamnose 3,5-epimerase [EC:5.1.3.13]
Organism
sui  Streptococcus suis JS14
Pathway
Streptomycin biosynthesis
Polyketide sugar unit biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:sui00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00523 Polyketide sugar unit biosynthesis
    SSUJS14_1262
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    SSUJS14_1262
Enzymes [BR:sui01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.13  dTDP-4-dehydrorhamnose 3,5-epimerase
     SSUJS14_1262
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Structure
PDB: 

Jmol
Position
complement(1263992..1264585)
Genome map
AA seq 197 aa AA seqDB search
MTENFFGKTLAARPVEAIPGMLEFDIPVHGDNRGWFKENFQKEKMLPLGFPESFFAEGKL
QNNVSFSRKNVLRGLHAEPWDKYISVADGGKVLGTWVDLREGETFGNTYQTVIDASKSIF
VPRGVANGFQVLSDFVAYSYLVNDYWALELKPKYAFVNYADPSLDIKWENLEEAEVSEAD
ENHPFLKDVKPLRKEDL
NT seq 594 nt NT seq  +upstreamnt  +downstreamnt
atgacagaaaactttttcggtaaaacactagcagctcgcccagttgaagctattccagga
atgttagaatttgacattcctgttcatggcgacaaccgtggctggtttaaggagaacttc
caaaaggaaaaaatgttgcctctcggctttcctgaaagcttctttgcagaaggaaaattg
cagaataatgtttccttctctcgtaaaaacgttcttcgtggtcttcacgcagagccttgg
gataaatacatttcagtagcagacggcggtaaggttttgggaacttgggtcgatctacgt
gaaggcgaaaccttcggtaatacctaccaaaccgttatcgatgcttcaaaaagtatcttc
gttccgcgcggagtagccaatggtttccaagtcttgtcagatttcgtggcttacagctac
ttggttaacgactactgggctttggaactcaagcctaagtatgctttcgtcaactacgct
gaccctagcctcgacatcaagtgggaaaacctagaagaagcagaagtttcagaagcagat
gaaaaccacccattcctcaaggacgtcaagcctttgagaaaagaggacctctaa

DBGET integrated database retrieval system