KEGG   Streptococcus suis JS14: SSUJS14_1342Help
Entry
SSUJS14_1342      CDS       T02024                                 

Definition
xylose isomerase
Orthology
K01805  
xylose isomerase [EC:5.3.1.5]
Organism
sui  Streptococcus suis JS14
Pathway
Pentose and glucuronate interconversions
Fructose and mannose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:sui00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    SSUJS14_1342
   00051 Fructose and mannose metabolism
    SSUJS14_1342
Enzymes [BR:sui01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.5  xylose isomerase
     SSUJS14_1342
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1347229..1348536)
Genome map
AA seq 435 aa AA seqDB search
MSYFPHLSPTKYEGTATTNPFAFRHYNPDEVIEGKTMKEHLRFALAYWHTMTQDGSDPFG
YPTNERTWFGETVMETAHNRVDAFFEILEKLGVDYFCFHDIDIAPAGDSLEEFFSNLDEI
TDHIKAKMEETGKKLLWNTANMFSHPRFNNGAASSNNAEVFAYAAAQVKKGLDISKKLGG
ENYVFWGGREGYESLINTDMKFEQENIARLFKMAIAYGEKIGHKPQFLIEPKPKEPSKHQ
YDFDAATTMAFILKHGLEGDFKLNLEANHATLAGHTFEHELNVARDFNALGSIDANQGDM
LLGWDTDEFPTNIYDTTFTMLEILANGGLAPGGINFDAKVRRSSFEMEDLLLAHIAGMDT
YARGLKAAAKIRSDRFLENLKEKRYASYKEGIGASILADKEDLESLTAYALEHDNPKLES
SHLELVKSKLNDYLV
NT seq 1308 nt NT seq  +upstreamnt  +downstreamnt
atgtcatatttcccacatttatcaccaactaaatatgaaggtacagcaacaacaaatcct
tttgcttttcgccattacaatcctgacgaggtgattgaaggtaaaacaatgaaagagcat
ttgcggtttgctcttgcttattggcataccatgacacaagatggttcagatccatttggt
tatccaacaaacgagcgcacatggtttggggaaactgttatggagacagctcacaatcga
gtggatgcgttttttgaaattcttgaaaaacttggagtggattatttctgtttccatgat
attgatattgctccggcgggggattctttagaagaattcttttctaaccttgatgaaatt
acagaccatattaaagcaaaaatggaagagacggggaaaaaacttctttggaatacagca
aatatgttttctcaccctcgtttcaacaatggtgcagcctcctcaaataatgcagaagtc
tttgcctatgcagctgctcaagttaagaaggggttggacatttctaaaaaacttggtggc
gaaaactatgtcttctggggcggacgtgaagggtacgaatctttgatcaatactgacatg
aagtttgagcaagaaaacattgcccgactcttcaaaatggcgattgcctacggtgaaaag
attggtcataagccacagttcttgattgagccaaaaccaaaagaaccgtcaaaacatcag
tatgattttgatgcggcgactaccatggccttcattctcaaacacggtcttgaaggagat
ttcaagttgaacctagaagctaaccacgcgacccttgcagggcacacctttgaacatgag
ctaaatgtggcgcgtgactttaatgctcttgggtcgattgacgccaaccaaggcgatatg
cttctgggctgggatacggatgagttcccgacaaacatctacgacaccacctttaccatg
cttgaaattttggcaaatggaggtctagcaccaggtggcatcaactttgatgctaaggtc
cgtcgttcatcctttgaaatggaagaccttcttttagctcatattgctggtatggatacc
tatgcgcgaggtttgaaagcggcagccaaaattcgctctgatcgtttcttagagaacttg
aaagaaaaacgctatgcgagctataaagaaggcattggtgccagcattcttgcagataag
gaagacttagaaagtctcactgcatatgccttggaacacgacaatccaaaattagaatcc
agccatttagagttagtcaaatcgaaattaaatgattatttagtataa

DBGET integrated database retrieval system