KEGG   Streptococcus suis JS14: SSUJS14_1525Help
Entry
SSUJS14_1525      CDS       T02024                                 

Definition
alpha-galactosidase
Orthology
K07407  
alpha-galactosidase [EC:3.2.1.22]
Organism
sui  Streptococcus suis JS14
Pathway
Galactose metabolism
Glycerolipid metabolism
Brite
KEGG Orthology (KO) [BR:sui00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    SSUJS14_1525
  Lipid metabolism
   00561 Glycerolipid metabolism
    SSUJS14_1525
   00600 Sphingolipid metabolism
    SSUJS14_1525
Enzymes [BR:sui01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.22  alpha-galactosidase
     SSUJS14_1525
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1525846..1528020)
Genome map
AA seq 724 aa AA seqDB search
MNVIEIYNEKQIFHLKTREFSYIIQVLETGDLVHRYFGKKIEKFSDGNKITYLDRSFSPS
PITGDRTYSLDVLPLEYSSNGLGDFRTSALDVRNEFGVTLDLKYKEYRLYKGKKELRGLP
ASFGNQEEVESLEIDLYDQLTDITVTLQYSVFEEASYLARSATIQTGKYPCKLEKVLSAT
LDFPHQDFIVHSLAGRYAYEKEWTQTPLTKGQYSIGSIRGASSHSRTPFLALVSPDASED
KGDVYAAHLVYSGNFTAFVETTAMETSRLGLGLESHYFSWQLDKDDRFQTPEVLLSYTDK
GFTGMTQNSHHFITKHLIRSSFVNKPRPILINNWEATYFEFTEEKILQLAQVASRAGIEL
FVLDDGWFGKRNNDESSLGDWKVNLDKLPNGLNGLAERINELGMKFGLWFEPEMISIDSD
LYREHPDWAIRTEGRLPIYSREQLVLDLTKQEVCDYIIDSVSSILESANISYVKWDMNRN
ITNIPEGLANDQRFEFHHRYMLGLYRVLDHLTKRFPDILFESCAGGGGRNDLGIMYYMPQ
AWASDDTDAIERLSIQEGTSLIYPPSSIGAHVSAVPNHQVGRITPLATRGNVAMMGGAFG
YELDLTKLSEKELDEISQQIETYHSIRETIQFGQLYRLKKTSNTWAANYVSQDKNQVVFT
FVKILAKPEAPLLHVRLKGLDPDALYECPQLGETFYGDELMNIGLTMPHVQKDYFSVQYI
FNKI
NT seq 2175 nt NT seq  +upstreamnt  +downstreamnt
atgaatgtgattgagatttataatgaaaaacagatttttcacctgaaaacaagagaattc
tcttatatcatccaagtattggaaacaggcgatctggttcatcgttattttgggaaaaaa
atcgaaaaatttagcgatggaaacaaaataacatatttagatcgatcgttttctccgagt
ccaattactggggataggacatactcattggatgtcctcccactcgaatattccagcaat
ggtctgggagattttagaacctcagcattagatgttcggaatgaatttggagtcactctt
gacctaaaatacaaagagtatcgattatacaaggggaaaaaagaactgaggggattacca
gcaagttttggaaatcaagaagaggtagagagtcttgaaattgatctttacgatcagttg
acagatattaccgtaactcttcagtattctgtttttgaagaagcttcctatctcgcacgg
tcagctacaattcaaactggcaaatatccatgcaaactagagaaggtcttgtctgcaacg
cttgattttccacatcaggatttcattgttcacagcttggcaggacgttatgcttatgaa
aaagagtggacacagaccccattgacaaaaggtcagtattcgattggtagcattcgaggt
gcttcaagtcactcaagaacaccctttttagcactagtttcacccgatgcaagtgaggac
aagggcgatgtttatgcagcccaccttgtttatagcggcaactttacagcatttgtcgaa
acgacagccatggaaaccagtcgtttgggactaggattggaaagtcactatttctcatgg
caattggataaggatgaccggtttcaaactccagaagttctcttatcatatactgataaa
ggatttactggcatgacacaaaatagtcatcactttatcacaaaacacctcattcgatca
tcgtttgtaaacaaaccaagacccattttaatcaacaactgggaagcgacctattttgaa
tttacagaagaaaagattttacagttagctcaggttgcaagtcgagctggtattgaattg
tttgttctggatgatggttggtttggtaaacgaaacaatgatgaaagttcattgggcgat
tggaaagtcaatttggataagttgccaaatggtttgaatggtttagcagagcgaataaat
gagcttggtatgaaattcggattgtggtttgaaccagagatgatttctattgatagcgat
ctttatcgtgagcatcctgattgggcaattcggacagaaggacgcttaccaatctacagc
cgagaacaattagttttggatttgaccaagcaggaagtctgtgactacatcattgatagc
gtctcttccatattagaatcagccaatatttcttatgtaaaatgggatatgaaccgtaat
atcaccaatattcctgaaggtttagcaaatgaccagcgctttgagttccaccatcgttac
atgctaggtctctaccgtgtattagaccaccttacaaagcggttcccggatattcttttc
gaatcctgtgcaggcggtggaggtcgtaatgatttgggaatcatgtattatatgccgcaa
gcttgggcaagtgatgatacagatgcgattgagcgcttatctattcaagaaggtactagt
ttgatttatcccccttcctcaattggtgcacacgtttctgccgttccaaaccatcaggtt
ggtcggatcacacctcttgctacacgaggcaatgtggctatgatgggaggagcatttggt
tacgagctggatttaacgaaactttcggaaaaggaattggatgaaatcagtcagcaaatc
gaaacctatcactccattcgtgaaactatacaattcggtcagctctaccgtctgaaaaag
acgagcaatacctgggctgccaattatgttagtcaagataagaatcaagtggtctttaca
tttgtaaaaattcttgccaagccagaagcgcctttgcttcatgttcggttgaaggggtta
gacccagatgccttgtatgaatgcccacaattaggagagacattctacggggatgaactg
atgaacattggtcttacaatgccacatgttcaaaaagattattttagtgtacaatatatt
tttaacaaaatctag

DBGET integrated database retrieval system