KEGG   Streptococcus suis JS14: SSUJS14_1589Help
Entry
SSUJS14_1589      CDS       T02024                                 

Gene name
murZ
Definition
UDP-N-acetylglucosamine 1-carboxyvinyltransferase 2
Orthology
K00790  
UDP-N-acetylglucosamine 1-carboxyvinyltransferase [EC:2.5.1.7]
Organism
sui  Streptococcus suis JS14
Pathway
Amino sugar and nucleotide sugar metabolism
Peptidoglycan biosynthesis
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Amino sugar and nucleotide sugar metabolism [PATH:sui00520]
Metabolism; Glycan biosynthesis and metabolism; Peptidoglycan biosynthesis [PATH:sui00550]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1576676..1577935)
Genome map
AA seq 419 aa AA seqDB search
MRKIVINGGKTLKGSVTVSGAKNSVVALIPAIILADGIVTLDGVPAISDVDSLVDIMETM
GATVKRDGETLEIDPRGVKDMPMPFGKINSLRASYYFYGSLLGRFGQAVVGLPGGCDLGP
RPIDLHLKAFAAMGAETTYEGDYMRLATNGQRIQGAHIFMDVVSVGATINTILAAVKAEG
RTVIENAAREPEIIDVATLLNNMGARIRGAGTDIITIEGVDSLKGTRHQVIPDRIEAGTY
IALAAAVGEGIRIDNVLYEHLESYIAKLEEMGVRMTISEDSIFVEKQEKLKAVSVKTSPY
PGFATDLQQPITPLLLKAEGTGTIVDTIYEKRVGHVQELANLGAKISTRNNHIAFEGPNQ
LTGTSVKATDLRAGAAMVIAGLMAQGRTEITNIEFILRGYSNIIDKLTELGADIQLIED
NT seq 1260 nt NT seq  +upstreamnt  +downstreamnt
atgagaaaaattgtaattaatggtggaaaaacactgaaagggtcggttaccgttagtggt
gcaaaaaactcagttgttgctcttattccggccattattcttgcagacgggattgttact
ctggacggagtacctgcaatctcggatgtagatagcttagttgatattatggaaacaatg
ggcgcgacggtcaagcgtgatggtgaaaccttggagattgaccctcgtggtgtaaaagac
atgcctatgccatttggcaaaattaatagcttgcgtgcatcctactatttttacggttcc
ctccttggtcgctttggtcaagctgttgttggcttgccaggtggttgtgatttgggaccg
cgtccgattgatttgcacttgaaagcattcgcggcaatgggagctgagacaacctatgaa
ggtgactatatgcgcttggcaactaatggtcagcgtattcaaggggcacatatcttcatg
gatgttgtcagcgtcggtgcgacaattaatactatcttagcagctgtcaaagcagaaggc
cgtacagttattgaaaatgcggcgcgtgaacctgaaattattgatgtggcaactttgctt
aataatatgggggcacgtatccgtggtgcgggtacagatattatcaccattgaaggcgta
gatagtctaaaaggaacacgtcatcaggtgattccagaccgtattgaagcagggacttat
attgcccttgctgctgctgttggtgaaggtattcgtatcgataatgtcctttatgaacac
ttagagagttacatcgctaagttggaagaaatgggtgttcgcatgaccatttctgaagat
agtatttttgttgaaaagcaagagaaattgaaggcggtaagtgtgaaaacttcaccttat
ccaggttttgcgacagacttgcagcaacccattactcctttactgcttaaggcagaaggg
actggtacgattgttgatacgatttatgaaaaacgtgttggtcatgtgcaggagcttgca
aatcttggagcaaaaatctctactcgtaacaaccatattgcctttgaaggtccaaatcaa
ctgactggtacatctgttaaagctactgatttgcgtgcgggagccgcaatggttatcgct
ggtttaatggctcaagggcgtacagaaattacaaacattgagtttattctacgtggttac
tcaaatattattgataaactgacagaattgggtgcagatattcaattgattgaggattag

DBGET integrated database retrieval system