KEGG   Streptococcus suis JS14: SSUJS14_1610Help
Entry
SSUJS14_1610      CDS       T02024                                 

Gene name
gpmA
Definition
phosphoglycerate mutase
Orthology
K01834  
2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Organism
sui  Streptococcus suis JS14
Pathway
Glycolysis / Gluconeogenesis
Glycine, serine and threonine metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:sui00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    SSUJS14_1610 (gpmA)
   01230 Biosynthesis of amino acids
    SSUJS14_1610 (gpmA)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    SSUJS14_1610 (gpmA)
  Energy metabolism
   00680 Methane metabolism
    SSUJS14_1610 (gpmA)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    SSUJS14_1610 (gpmA)
Enzymes [BR:sui01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.11  phosphoglycerate mutase (2,3-diphosphoglycerate-dependent)
     SSUJS14_1610 (gpmA)
Exosome [BR:sui04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   SSUJS14_1610 (gpmA)
  Exosomal proteins of melanoma cells
   SSUJS14_1610 (gpmA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
complement(1592896..1593588)
Genome map
AA seq 230 aa AA seqDB search
MVKLVFARHGESEWNKANLFTGWADVDLSEKGTQQAIDAGKLIKEAGIEFDLAFTSVLKR
AIKTTNLALEAADQLWVPVEKSWRLNERHYGGLTGLNKAEAAAEFGDEQVHIWRRSYDTL
PPEMAKDHEHSAHTDRRYAHLDDSVIPDAENLKVTLERALPFWEDKIAPALKDGKNVFVG
AHGNSIRALVKHIKQLSDDEIMDVEIPNFPPLVFELDENLNIVKEYYLEA
NT seq 693 nt NT seq  +upstreamnt  +downstreamnt
atggtaaaattggtttttgctcgccatggtgagtctgaatggaacaaagctaaccttttc
actggttgggctgatgttgatttgtctgaaaaaggtacacaacaagcaatcgatgcaggt
aaattgatcaaagaagcaggtatcgaatttgaccttgctttcacatctgtattgaaacgt
gctatcaagactacaaacttggctcttgaagctgcagatcaattgtgggtaccagttgaa
aaatcgtggcgtttgaacgaacgtcactacggtggtttgactggcttgaacaaagctgaa
gcagctgctgaatttggtgatgagcaagttcacatctggcgtcgttcttatgatactttg
ccaccagaaatggctaaagatcatgagcattcagcacacactgaccgtcgctatgcacac
cttgatgattcagttattccagatgcagaaaacttgaaagtaacgcttgagcgtgccctt
ccattctgggaagataaaattgctccagcattgaaagacggtaaaaacgtattcgtgggt
gcacacggtaactcaatccgtgcccttgtaaaacacatcaaacaattgtctgatgacgaa
atcatggatgtggaaattccaaacttcccaccacttgtattcgaattggatgaaaacttg
aacattgtgaaagagtactacttggaagcataa

DBGET integrated database retrieval system