KEGG   Streptococcus suis JS14: SSUJS14_1610Help
Entry
SSUJS14_1610      CDS       T02024                                 

Gene name
gpmA
Definition
(GenBank) phosphoglycerate mutase 1
  KO
K01834  2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Organism
sui  Streptococcus suis JS14
Pathway
sui00010  Glycolysis / Gluconeogenesis
sui00260  Glycine, serine and threonine metabolism
sui00680  Methane metabolism
sui01100  Metabolic pathways
sui01110  Biosynthesis of secondary metabolites
sui01120  Microbial metabolism in diverse environments
sui01130  Biosynthesis of antibiotics
sui01200  Carbon metabolism
sui01230  Biosynthesis of amino acids
Module
sui_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
sui_M00002  Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:sui00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    SSUJS14_1610 (gpmA)
  Energy metabolism
   00680 Methane metabolism
    SSUJS14_1610 (gpmA)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    SSUJS14_1610 (gpmA)
Enzymes [BR:sui01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.11  phosphoglycerate mutase (2,3-diphosphoglycerate-dependent)
     SSUJS14_1610 (gpmA)
Membrane trafficking [BR:sui04131]
 Autophagy
  Chaperone mediated autophagy (CMA)
   Selective cargos
    SSUJS14_1610 (gpmA)
Exosome [BR:sui04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   SSUJS14_1610 (gpmA)
  Exosomal proteins of melanoma cells
   SSUJS14_1610 (gpmA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: His_Phos_1 Imm70
Motif
Other DBs
NCBI-ProteinID: ADV70670
Position
complement(1592896..1593588)
Genome map
AA seq 230 aa AA seqDB search
MVKLVFARHGESEWNKANLFTGWADVDLSEKGTQQAIDAGKLIKEAGIEFDLAFTSVLKR
AIKTTNLALEAADQLWVPVEKSWRLNERHYGGLTGLNKAEAAAEFGDEQVHIWRRSYDTL
PPEMAKDHEHSAHTDRRYAHLDDSVIPDAENLKVTLERALPFWEDKIAPALKDGKNVFVG
AHGNSIRALVKHIKQLSDDEIMDVEIPNFPPLVFELDENLNIVKEYYLEA
NT seq 693 nt NT seq  +upstreamnt  +downstreamnt
atggtaaaattggtttttgctcgccatggtgagtctgaatggaacaaagctaaccttttc
actggttgggctgatgttgatttgtctgaaaaaggtacacaacaagcaatcgatgcaggt
aaattgatcaaagaagcaggtatcgaatttgaccttgctttcacatctgtattgaaacgt
gctatcaagactacaaacttggctcttgaagctgcagatcaattgtgggtaccagttgaa
aaatcgtggcgtttgaacgaacgtcactacggtggtttgactggcttgaacaaagctgaa
gcagctgctgaatttggtgatgagcaagttcacatctggcgtcgttcttatgatactttg
ccaccagaaatggctaaagatcatgagcattcagcacacactgaccgtcgctatgcacac
cttgatgattcagttattccagatgcagaaaacttgaaagtaacgcttgagcgtgccctt
ccattctgggaagataaaattgctccagcattgaaagacggtaaaaacgtattcgtgggt
gcacacggtaactcaatccgtgcccttgtaaaacacatcaaacaattgtctgatgacgaa
atcatggatgtggaaattccaaacttcccaccacttgtattcgaattggatgaaaacttg
aacattgtgaaagagtactacttggaagcataa

DBGET integrated database retrieval system