KEGG   Streptococcus suis JS14: SSUJS14_1688Help
Entry
SSUJS14_1688      CDS       T02024                                 

Gene name
murC
Definition
UDP-N-acetylmuramate--L-alanine ligase
Orthology
K01924  
UDP-N-acetylmuramate--alanine ligase [EC:6.3.2.8]
Organism
sui  Streptococcus suis JS14
Pathway
D-Glutamine and D-glutamate metabolism
Peptidoglycan biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:sui00001]
 Metabolism
  Metabolism of other amino acids
   00471 D-Glutamine and D-glutamate metabolism
    SSUJS14_1688 (murC)
  Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    SSUJS14_1688 (murC)
Enzymes [BR:sui01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.8  UDP-N-acetylmuramate---L-alanine ligase
     SSUJS14_1688 (murC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1665185..1666516)
Genome map
AA seq 443 aa AA seqDB search
MTKTYHFIGIKGSGMSALALMLHQMGHKVQGSDVEKYYFTQRGLEQAGIQILPFDEKNIT
ADVELIAGNAFRPDNNVEIAYADAQGYTYKRYHEFLGEFMKGFTSLGVAGAHGKTSTTGL
LAHVMRNITDTSFLIGDGTGRGSANAQYFVFESDEYERHFAPYHPEYSIITNIDFDHPDY
FTSLEDVFNAFNDYAKQVKNALFVFGEDEQLRRITANAPIYYYGLEDNNDFVAYDLKPST
SGSQFKVRHGEEELGEFQIPTFGKHNVMNATAVIANLYIAGFDLQLVAEHLKTFGGVKRR
FTEKIVNDTVIIDDFAHHPTEIIATIDAARQKYPSKELVAIFQPHTFTRTIALLDEFADA
LNGADAVYLAQIYGSARETDNGQVKVEDLAAKINKKGGLVTVENTSPLLDHDNAVYVFMG
AGDIQSYEYSFERLLSNLTNNVQ
NT seq 1332 nt NT seq  +upstreamnt  +downstreamnt
atgacaaaaacctatcattttatcggaattaagggatcgggtatgagcgcacttgctctt
atgttgcatcaaatggggcataaggttcaaggtagtgatgtagagaaatactactttaca
caacgcgggcttgaacaagctgggattcagattttaccgtttgatgagaaaaatattaca
gcagatgttgaattgattgctggtaatgcttttcgtccagataacaatgtggaaatcgct
tatgctgatgcccagggctatacctacaaacgttaccatgaatttttaggtgaatttatg
aaaggttttacgagcctcggtgttgctggtgcccatggtaagacctctacaacgggatta
ttggcacatgttatgcgcaatatcacagatacttccttcttgattggtgatggtactggt
cgcggttcggcaaatgctcagtattttgtgttcgaatccgatgaatacgaacgtcacttt
gccccataccatcctgaatacagcatcattaccaatattgattttgaccatccagattat
ttcactagtctagaggatgttttcaatgctttcaatgattatgcgaagcaagtaaaaaat
gctctcttcgtttttggtgaagatgagcaacttcgtcgtatcacggcaaatgctccaatc
tactattatggcttggaagacaataatgattttgttgcctatgacttgaagccttctaca
agtggttcacaattcaaagttcgccatggtgaagaagagttgggagaattccaaattcca
acctttggtaagcataatgtgatgaatgcaacagctgttattgccaatctctatattgct
ggatttgatttgcaactggttgcagaacacttgaagacatttggaggtgtcaaacgtcgc
tttacggagaaaattgtcaatgatactgttatcattgatgactttgctcaccatccaacg
gaaatcattgcaaccattgatgcggcacgtcagaagtatcctagcaaggagttggtagcc
atcttccaaccacatacattcactcgtaccattgcgcttctcgatgagtttgcagatgct
ttgaatggagcagatgcagtttaccttgctcaaatttatggatcagcgcgtgaaacagac
aatggtcaggttaaggtagaagatttggcggctaaaatcaacaaaaaaggtggacttgtt
acagttgaaaacacttcaccacttttagaccatgacaatgccgtatatgtatttatggga
gctggtgatattcagtcctatgaatattccttcgaaagactcttgtcaaatcttacaaat
aacgtccaataa

DBGET integrated database retrieval system