KEGG   Staphylococcus aureus subsp. aureus JKD6159: SAA6159_00244Help
Entry
SAA6159_00244     CDS       T01870                                 

Gene name
bglA
Definition
glycoside hydrolase
Orthology
K01223  
6-phospho-beta-glucosidase [EC:3.2.1.86]
Organism
suj  Staphylococcus aureus subsp. aureus JKD6159
Pathway
Glycolysis / Gluconeogenesis
Class
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:suj00010]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
292940..294376
Genome map
AA seq 478 aa AA seqDB search
MTNLPQNFMWGGALAANQFEGGYDKGGKGLSVIDVMTSGAHGKARQITESIDPNHYYPNH
EGIDFYHRYKEDIALFKEMGLKCLRTSIAWTRIFPNGDEDVPNEEGLAFYDRIFDELIAQ
GIEPVVTLSHFEMPLHLAKHYGGFRNREVVDYFVHFARVVFERYKDKVTYWMTFNEINNQ
MDTSNPIFLWTNSGVALTENDNPEEVLYQVAHHELLASALAVRLGKEINPKFKIGTMISH
VPIYPYSCHPKDMMEAQIANRLRFFFPDVQVRGYYPSYAKKMLARKGYDFGWQEGDDSIL
QQGTVDYIGFSYYMSTAVKHDVDTTVENNIVNGGLNHSVENPHIATSDWGWAIDPDGLRY
TLNVLYNRYQLPLFIVENGFGAVDEVVDGHIHDDYRIEYLKAHITAAIEAVDQDGVDLIG
YTPWGIIDIVSFTTGEMKKRYGLIYVDRDNDGHGTMERLKKDSFYWYQQVIASNGDKL
NT seq 1437 nt NT seq  +upstreamnt  +downstreamnt
atgacaaatttaccgcaaaattttatgtggggtggcgcacttgccgcaaatcaatttgaa
ggtggatatgataaaggtggcaaaggattaagtgtaattgatgttatgacgagtggtgca
catggcaaagcacgtcagattacagaatctatagaccccaatcactattatccaaatcat
gaaggtattgatttttatcatcgttataaggaagatattgccttgtttaaagaaatggga
ttgaaatgtttacgtacgtcgattgcgtggacacgtatctttccaaatggggatgaagat
gtgccaaatgaagaaggactcgccttttatgatcgtatctttgatgaattaattgcacaa
ggtattgaacctgttgtgactttatcacattttgagatgccacttcatttagcgaaacat
tatggtggatttagaaatagagaagttgtcgattattttgtgcattttgcgcgtgttgta
tttgaaagatataaagataaagtgacatattggatgacgtttaatgaaattaataatcag
atggacacatcaaatcctatctttttatggacgaattctggggtagcattaacagaaaat
gataatcccgaagaagtcttgtatcaagtagcacatcatgaacttttagccagtgcttta
gcggttcgtcttggtaaagagattaatccgaaatttaagattggaacaatgatttcacat
gtacccatttatccatattcgtgtcatccgaaagatatgatggaagcacaaattgcgaat
cgcttacgtttctttttcccggatgttcaagtaagaggttattatccaagctatgctaaa
aaaatgttggcacgaaaaggatatgattttggatggcaagaaggggacgacagtatttta
cagcagggcacggttgattatattggctttagttattacatgtctacggctgtaaaacat
gatgttgatactacagttgaaaacaacatcgtcaacggtggtttgaatcattctgtggag
aatccgcatatcgcaacgagtgattggggttgggcgattgatccagatggcttaagatat
acattgaatgtgttatataatcgttatcagttgccactttttattgtggaaaatggtttt
ggtgcagttgatgaagtggtagatggacatattcatgatgattatcgcattgaatattta
aaagcacatattacagcagcgatagaagcagttgatcaagatggtgtagatttaatcggt
tatacgccatggggaatcattgatattgtttcatttacaaccggtgaaatgaagaaacgt
tatggtttaatatatgttgatcgagataatgatggtcatggcacgatggaacgattgaaa
aaagattcgttctattggtatcaacaagtgatagcatcaaatggagataaattataa

DBGET integrated database retrieval system