KEGG   Staphylococcus aureus subsp. aureus JKD6159: SAA6159_00244Help
Entry
SAA6159_00244     CDS       T01870                                 

Gene name
bglA
Definition
glycoside hydrolase
Orthology
K01223  
6-phospho-beta-glucosidase [EC:3.2.1.86]
Organism
suj  Staphylococcus aureus subsp. aureus JKD6159
Pathway
Glycolysis / Gluconeogenesis
Brite
KEGG Orthology (KO) [BR:suj00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    SAA6159_00244 (bglA)
Enzymes [BR:suj01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.86  6-phospho-beta-glucosidase
     SAA6159_00244 (bglA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
292940..294376
Genome map
AA seq 478 aa AA seqDB search
MTNLPQNFMWGGALAANQFEGGYDKGGKGLSVIDVMTSGAHGKARQITESIDPNHYYPNH
EGIDFYHRYKEDIALFKEMGLKCLRTSIAWTRIFPNGDEDVPNEEGLAFYDRIFDELIAQ
GIEPVVTLSHFEMPLHLAKHYGGFRNREVVDYFVHFARVVFERYKDKVTYWMTFNEINNQ
MDTSNPIFLWTNSGVALTENDNPEEVLYQVAHHELLASALAVRLGKEINPKFKIGTMISH
VPIYPYSCHPKDMMEAQIANRLRFFFPDVQVRGYYPSYAKKMLARKGYDFGWQEGDDSIL
QQGTVDYIGFSYYMSTAVKHDVDTTVENNIVNGGLNHSVENPHIATSDWGWAIDPDGLRY
TLNVLYNRYQLPLFIVENGFGAVDEVVDGHIHDDYRIEYLKAHITAAIEAVDQDGVDLIG
YTPWGIIDIVSFTTGEMKKRYGLIYVDRDNDGHGTMERLKKDSFYWYQQVIASNGDKL
NT seq 1437 nt NT seq  +upstreamnt  +downstreamnt
atgacaaatttaccgcaaaattttatgtggggtggcgcacttgccgcaaatcaatttgaa
ggtggatatgataaaggtggcaaaggattaagtgtaattgatgttatgacgagtggtgca
catggcaaagcacgtcagattacagaatctatagaccccaatcactattatccaaatcat
gaaggtattgatttttatcatcgttataaggaagatattgccttgtttaaagaaatggga
ttgaaatgtttacgtacgtcgattgcgtggacacgtatctttccaaatggggatgaagat
gtgccaaatgaagaaggactcgccttttatgatcgtatctttgatgaattaattgcacaa
ggtattgaacctgttgtgactttatcacattttgagatgccacttcatttagcgaaacat
tatggtggatttagaaatagagaagttgtcgattattttgtgcattttgcgcgtgttgta
tttgaaagatataaagataaagtgacatattggatgacgtttaatgaaattaataatcag
atggacacatcaaatcctatctttttatggacgaattctggggtagcattaacagaaaat
gataatcccgaagaagtcttgtatcaagtagcacatcatgaacttttagccagtgcttta
gcggttcgtcttggtaaagagattaatccgaaatttaagattggaacaatgatttcacat
gtacccatttatccatattcgtgtcatccgaaagatatgatggaagcacaaattgcgaat
cgcttacgtttctttttcccggatgttcaagtaagaggttattatccaagctatgctaaa
aaaatgttggcacgaaaaggatatgattttggatggcaagaaggggacgacagtatttta
cagcagggcacggttgattatattggctttagttattacatgtctacggctgtaaaacat
gatgttgatactacagttgaaaacaacatcgtcaacggtggtttgaatcattctgtggag
aatccgcatatcgcaacgagtgattggggttgggcgattgatccagatggcttaagatat
acattgaatgtgttatataatcgttatcagttgccactttttattgtggaaaatggtttt
ggtgcagttgatgaagtggtagatggacatattcatgatgattatcgcattgaatattta
aaagcacatattacagcagcgatagaagcagttgatcaagatggtgtagatttaatcggt
tatacgccatggggaatcattgatattgtttcatttacaaccggtgaaatgaagaaacgt
tatggtttaatatatgttgatcgagataatgatggtcatggcacgatggaacgattgaaa
aaagattcgttctattggtatcaacaagtgatagcatcaaatggagataaattataa

DBGET integrated database retrieval system