KEGG   Staphylococcus aureus subsp. aureus JKD6159: SAA6159_00407Help
Entry
SAA6159_00407     CDS       T01870                                 

Definition
esterase/lipase
Orthology
K03928  
carboxylesterase [EC:3.1.1.1]
Organism
suj  Staphylococcus aureus subsp. aureus JKD6159
Brite
Enzymes [BR:suj01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.1  carboxylesterase
     SAA6159_00407
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
460411..461145
Genome map
AA seq 244 aa AA seqDB search
MRIKTPSPSYLKGTNGHAILLLHSFTGTNRDVKHLAAELNDQGFSCYAPNYPGHGLLLKD
FMTYNVDDWWEEVEKAYQFLVNEGYESISATGVSLGGLMTLKLAQHYPLKRIAVMSAPKE
KSDDGLIEHLVYYSQRMSDILNLDQQASSAQLAAIDDYEGEITKFQHFIDDIMTNLNVIK
MPANILFGGKDAPSYETSAHFIYEHLGSVDKELNGLKDSHHLMTHGEGRDVLEENVIRFF
NALT
NT seq 735 nt NT seq  +upstreamnt  +downstreamnt
atgagaattaaaacaccgagtccatcttatttaaaaggcacaaatggacatgcgatatta
ttattacattcatttacaggtacaaatcgggatgtgaagcatcttgcagctgagttaaat
gatcaaggatttagttgttatgcaccgaattatccaggtcatggcttactgttgaaagat
ttcatgacatataatgtagatgattggtgggaagaagttgagaaagcttaccaattttta
gtcaatgaaggttatgaatctatcagtgcaacgggtgtgtctttaggtggattaatgaca
ttaaaattggcgcaacactatcctttgaaacgtatcgctgtcatgtcagcaccaaaggaa
aagagtgacgatggtttaatagaacatttagtttattatagtcaacgcatgtcggatatt
ttaaatttagatcagcaagcatcgagtgcgcaattagcagcaattgatgattatgaaggt
gaaattacgaagtttcaacattttattgatgatatcatgacaaatttaaatgttattaaa
atgccagctaatatattatttggtggtaaagatgcgccatcctatgaaacaagtgcacac
tttatttatgaacatttaggatcagtagacaaagaattaaatggtctgaaggattcgcat
catttaatgacgcatggagaaggcagagatgttttagaagaaaatgttattcgctttttc
aatgctttaacataa

DBGET integrated database retrieval system