KEGG   Staphylococcus aureus subsp. aureus JKD6159: SAA6159_00510Help
Entry
SAA6159_00510     CDS       T01870                                 

Definition
deoxynucleoside kinase
Orthology
K15519  
deoxyadenosine/deoxycytidine kinase [EC:2.7.1.76 2.7.1.74]
Organism
suj  Staphylococcus aureus subsp. aureus JKD6159
Pathway
Purine metabolism
Pyrimidine metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:suj00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    SAA6159_00510
   00240 Pyrimidine metabolism
    SAA6159_00510
Enzymes [BR:suj01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.74  deoxycytidine kinase
     SAA6159_00510
    2.7.1.76  2'-deoxyadenosine kinase
     SAA6159_00510
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(585141..585803)
Genome map
AA seq 220 aa AA seqDB search
MNNYGIPQNAIITIAGTVGVGKSTLTQALADKLNFKTSFENVEHNPYLDKFYSDFERWSF
HLQIYFLAERFKEQKRMFEYGGGFVQDRSIYEDVDIFAKMHEEEGTMSKEDFKTYSDLFN
AMVMTPYFPKPDVMIYLECNYDEVIDRIIERGREMEINTDPEYWKKLFKRYDDWINSFNA
CPVVRININEYDIHKDPDSLNPMIDKIARIIKTYRQVDTR
NT seq 663 nt NT seq  +upstreamnt  +downstreamnt
atgaataattacggtattccacaaaatgccattataaccattgcaggtacagttggtgtt
gggaaatcaacactaacgcaagcacttgcagataaattaaactttaaaacgtcttttgaa
aatgtcgaacataatccatatttagataaattttacagcgattttgaacgatggagtttc
catttgcaaatttacttcttagctgaacgttttaaagaacaaaagcgtatgtttgaatat
ggtggtggctttgtccaagatcgatcaatttatgaagatgttgatatttttgcaaaaatg
catgaagaagaaggcacaatgagtaaagaggatttcaaaacatattcagacttatttaat
gccatggtcatgacaccttattttcctaaacctgacgtaatgatttatttagaatgtaac
tatgatgaggtcattgatcgtattattgaacgtggtcgcgaaatggaaataaatactgat
cctgaatattggaaaaagttatttaaacgttatgacgattggattaacagctttaatgca
tgtccagttgtacgtataaatattaatgaatatgatatacacaaagatcctgattcttta
aatcctatgattgataaaatcgctcgtattataaaaacgtatcgacaagtagatacacga
taa

DBGET integrated database retrieval system