KEGG   Staphylococcus aureus subsp. aureus JKD6159 (CA-MRSA): SAA6159_00529Help
Entry
SAA6159_00529     CDS       T01870                                 

Gene name
vraB
Definition
(GenBank) acetyl-CoA C-acetyltransferase VraB
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
suj  Staphylococcus aureus subsp. aureus JKD6159 (CA-MRSA)
Pathway
suj00071  Fatty acid degradation
suj00072  Synthesis and degradation of ketone bodies
suj00280  Valine, leucine and isoleucine degradation
suj00310  Lysine degradation
suj00362  Benzoate degradation
suj00380  Tryptophan metabolism
suj00620  Pyruvate metabolism
suj00630  Glyoxylate and dicarboxylate metabolism
suj00640  Propanoate metabolism
suj00650  Butanoate metabolism
suj00900  Terpenoid backbone biosynthesis
suj01100  Metabolic pathways
suj01110  Biosynthesis of secondary metabolites
suj01120  Microbial metabolism in diverse environments
suj01130  Biosynthesis of antibiotics
suj01200  Carbon metabolism
suj01212  Fatty acid metabolism
suj02020  Two-component system
Brite
KEGG Orthology (KO) [BR:suj00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    SAA6159_00529 (vraB)
   00630 Glyoxylate and dicarboxylate metabolism
    SAA6159_00529 (vraB)
   00640 Propanoate metabolism
    SAA6159_00529 (vraB)
   00650 Butanoate metabolism
    SAA6159_00529 (vraB)
  Lipid metabolism
   00071 Fatty acid degradation
    SAA6159_00529 (vraB)
   00072 Synthesis and degradation of ketone bodies
    SAA6159_00529 (vraB)
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    SAA6159_00529 (vraB)
   00310 Lysine degradation
    SAA6159_00529 (vraB)
   00380 Tryptophan metabolism
    SAA6159_00529 (vraB)
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    SAA6159_00529 (vraB)
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    SAA6159_00529 (vraB)
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    SAA6159_00529 (vraB)
Enzymes [BR:suj01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     SAA6159_00529 (vraB)
Exosome [BR:suj04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   SAA6159_00529 (vraB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt
Motif
Other DBs
NCBI-ProteinID: ADL22481
Position
612981..614120
Genome map
AA seq 379 aa AA seqDB search
MNQAVIVAAKRTAFGKYGGTLKHLEPEQLLKPLFQHFKEKYPEVISKIDDVVLGNVVGNG
GNIARKALLEAGLKDSIPGVTIDRQCGSGLESVQYACRMIQAGAGKVYIAGGVESTSRAP
WKIKRPHSVYETALPEFYERASFAPEMSDPSMIQGAENVAKMYDISRELQDEFAYRSHQL
TAENVKNGNISQEILPITVKGEIFNTDESLKSHIPKDNFGRFKPVIKGGTVTAANSCMKN
DGAVLLLIMEKDMAYELGFEHGLLFKDGVTVGVDSNFPGIGPVPAISNLLKRNQLTIENI
EVIEINEAFSAQVVACQQALNISNTQLNIWGGALASGHPYGASGAQLVTRLFYMFDKEIM
IASMGIGGGLGNAALFTRF
NT seq 1140 nt NT seq  +upstreamnt  +downstreamnt
atgaatcaagcagtcatagttgcagctaaacgaactgcatttgggaaatatggaggcact
ttaaaacatttagagccagaacaattgctcaaacctttattccaacattttaaagagaag
tatccagaggtaatatctaaaatagatgatgtagttttaggtaatgttgttgggaatggt
ggcaatattgcaagaaaagcattgcttgaagcggggctcaaagattcaatacctggcgtc
acaatcgatcggcaatgtgggtctggacttgaaagtgttcaatatgcatgtcgcatgatt
caagccggagctggcaaggtatatattgcaggcggtgttgaaagtacaagtcgagcacct
tggaaaatcaaacgaccgcattctgtgtacgaaacagcattacctgagttttatgagcgt
gcatcatttgcacctgaaatgagcgacccatcaatgattcaaggtgctgaaaatgtagcc
aagatgtatgatatttcaagagaattacaagatgaatttgcttatcgaagtcatcaattg
acagcggaaaatgtaaagaatggaaatatttctcaggaaatattacctataaccgttaaa
ggagaaatattcaacactgatgaaagtctaaaatcacatattccgaaagataactttggc
cgatttaagcccgtgatcaaaggtgggaccgttaccgctgcgaatagttgtatgaaaaat
gatggtgcagttttattgcttattatggaaaaagatatggcatacgaattaggtttcgag
catggtttattatttaaagatggtgttacggtaggtgttgattctaattttcctggcatt
ggtccagtaccagccatttccaacttactaaaaagaaatcaattaacgatagaaaatatt
gaagtcatcgaaattaacgaagcgttcagtgcacaggtggttgcctgccaacaagcttta
aatatttcaaatacgcaattaaatatatggggtggtgcattagcatcaggtcatccatac
ggtgcaagcggtgcccaattagtgactcgattattttatatgtttgacaaagagattatg
attgcatctatggggatagggggaggtctaggaaatgcagcattattcactcgattctaa

DBGET integrated database retrieval system