KEGG   Staphylococcus aureus subsp. aureus JKD6159: SAA6159_00654Help
Entry
SAA6159_00654     CDS       T01870                                 

Gene name
pfkB
Definition
fructose 1-phosphate kinase
Orthology
K00882  
1-phosphofructokinase [EC:2.7.1.56]
Organism
suj  Staphylococcus aureus subsp. aureus JKD6159
Pathway
Fructose and mannose metabolism
Brite
KEGG Orthology (KO) [BR:suj00001]
 Metabolism
  Carbohydrate metabolism
   00051 Fructose and mannose metabolism
    SAA6159_00654 (pfkB)
Enzymes [BR:suj01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.56  1-phosphofructokinase
     SAA6159_00654 (pfkB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
730847..731767
Genome map
AA seq 306 aa AA seqDB search
MIYTVTFNPSIDYVIFTNDFKIDGLNRATATYKFAGGKGINVSRVLKTLDVESTALGFAG
GFPGKFIIDTLNNSAIQSNFIEVDEDTRINVKLKTGQETEINAPGPHITSTQFEQLLQQI
KNTTSEDIVIVAGSVPSSIPSDAYAQIAQITAQTGAKLVVDAEKELAESVLPYHPLFIKP
NKDELEVMFNTTVNSDADVIKYGRLLVDKGAQSVIVSLGGDGAIYIDKEISIKAVNPQGK
VVNTVGSGDSTVAGMVAGIASGLTIEKAFQQAVACGTATAFDEDLATRDAIGKIKSQVTI
SVLDGE
NT seq 921 nt NT seq  +upstreamnt  +downstreamnt
atgatttatacagtgactttcaatccttcaattgactatgtcatttttacgaatgatttt
aaaattgatggtttgaacagagcaacagcaacatataaattcgctgggggaaaaggtatt
aatgtctcacgtgttttaaagacattggatgttgaatcaactgctttgggatttgcaggt
ggatttcctgggaaattcattatagatacattaaataatagtgcaattcaatcgaatttt
attgaagttgatgaagatacacgtattaatgtgaaattaaaaacaggacaagaaacagaa
atcaatgcaccgggtcctcatataacgtcaacacaatttgaacaactgttacaacaaatt
aaaaatacaacaagcgaagatatagttattgttgctggaagtgtaccaagtagtattcca
agcgatgcgtatgcacaaattgcacaaattacagcacagacaggtgctaaattagtagtc
gacgctgaaaaagaattggctgaaagcgttttaccatatcatccactatttattaaacct
aataaagatgaattagaagtgatgtttaatacaacagtgaactcagacgcagatgttatt
aaatatggtcgtttgctagttgataaaggtgcgcaatctgttattgtctcacttggcggt
gatggtgctatttatattgataaagaaatcagtattaaagcagttaatccacaagggaaa
gtggttaatacagttggctctggtgatagtacagttgcaggcatggtggctggaattgct
tcaggtttaacgattgaaaaagcattccaacaagcagtagcatgcggtactgccacggca
tttgatgaggacttagcaacacgggacgctataggaaaaataaaatcacaagttacgatt
agcgtacttgatggggagtga

DBGET integrated database retrieval system