KEGG   Staphylococcus aureus subsp. aureus JKD6159: SAA6159_00736Help
Entry
SAA6159_00736     CDS       T01870                                 

Gene name
est
Definition
carboxyesterase -like protein
Orthology
K03928  
carboxylesterase [EC:3.1.1.1]
Organism
suj  Staphylococcus aureus subsp. aureus JKD6159
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
826578..827318
Genome map
AA seq 246 aa AA seqDB search
MQIKLPKPFFFEEGKRAVLLLHGFTGNSSDVRQLGRFLQKKGYTSYAPQYEGHAAPPEEI
LQSSPFVWFKDALDGYDYLVEQGYDEIVVAGLSLGGDFALKLSLNRDVKGIVTMCAPMGG
KTEGAIYEGFLEYARNFKKYEGKDQETIDNEMHHFKPTETLKELSEALDTIKEQVDEVLD
PILVIQAENDKMIDPQSANYIYDHVDSDDKDIKWYSESGHVITIDKEKEQVFEDIYQFLE
SLDWSE
NT seq 741 nt NT seq  +upstreamnt  +downstreamnt
atgcaaataaagttaccaaagcctttcttttttgaggaaggtaaacgtgccgtgttatta
ctacatggttttacaggcaattcgtctgatgttcgtcaattaggtcgatttttacaaaag
aaaggttatacatcgtatgcaccgcaatatgaaggtcatgcagcaccaccagaagagata
cttcaatcaagtccttttgtttggtttaaagatgccttagatggctatgactaccttgtt
gaacaaggttatgatgaaatcgttgttgctggcttgtcattaggtggcgattttgcatta
aaattaagcttaaatcgagatgtaaagggtattgtaacgatgtgtgctcctatgggtggc
aaaactgaaggtgccatttatgaaggctttttagagtatgcacgcaattttaaaaagtat
gagggtaaagatcaagaaacgatcgataacgaaatgcatcatttcaaaccaactgaaact
ttaaaagaattaagtgaagcattagatacgattaaagagcaagttgatgaagtgttggat
cctattttagtgattcaagctgaaaacgacaaaatgattgatccacaatccgcaaattat
atatatgaccatgtagattctgatgacaaagatatcaagtggtacagtgaatctggacat
gttattacgattgataaagagaaagaacaagtatttgaagatatttatcaatttttagag
tcattagattggtcagaataa

DBGET integrated database retrieval system