KEGG   Staphylococcus aureus subsp. aureus JKD6159: SAA6159_01240Help
Entry
SAA6159_01240     CDS       T01870                                 

Gene name
trpA
Definition
tryptophan synthase subunit alpha
Orthology
K01695  
tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
suj  Staphylococcus aureus subsp. aureus JKD6159
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:suj00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    SAA6159_01240 (trpA)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    SAA6159_01240 (trpA)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    SAA6159_01240 (trpA)
Enzymes [BR:suj01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     SAA6159_01240 (trpA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1364929..1365657
Genome map
AA seq 242 aa AA seqDB search
MTKLFIPYIMGNKDLIENATLLSENGADIIEIGVPFSDPVADGPVIMEAGQQAIKQGITI
DYIFEQLEKHGNQIKCQYVLMTYYNIICHYGEQAFFEKCRDTGVYGLIIPDLPFELSQRL
KQQFSHYGVKIISLVAMTTDDKRIKEIVSHAEGFIYTVTMNATTGQNGAFRPELKRKIES
IKAIANVPVVAGFGIRTPQHVADIKEVADGIVIGSEIVKRFKANTREEIIKYLQSIQHAL
NN
NT seq 729 nt NT seq  +upstreamnt  +downstreamnt
atgactaaattatttataccttatattatgggcaataaagatttgattgaaaatgcaaca
ttgttgagtgaaaatggtgcagatataattgaaattggtgtacctttctctgatccggtt
gctgatggtccagttatcatggaagcaggtcaacaagcgattaaacaaggcataacgata
gattatattttcgagcaattagaaaaacacggtaatcaaattaagtgtcagtatgtatta
atgacgtattataatattatttgtcattatggagaacaagcgttttttgaaaaatgtcga
gataccggtgtctacggcttaattattcctgatttaccatttgaattatcgcagcgttta
aaacaacaatttagtcactatggcgtcaaaattatatcgttagttgcgatgactactgat
gacaaacgtataaaagaaatcgtatcccatgcggaagggtttatttatactgtgacgatg
aatgcgacaacaggacaaaacggtgcgtttcgcccagaattaaaacgaaaaattgagtca
attaaagcgatagccaatgtgccagttgtcgcaggatttggtataagaactccacaacat
gttgcagatataaaagaggtcgcagatggtatcgttattggtagtgaaatcgttaagcga
tttaaagctaacacgcgtgaagaaatcattaaatatttacaatctatccagcatgcattg
aataattaa

DBGET integrated database retrieval system