KEGG   Staphylococcus aureus subsp. aureus JKD6159 (CA-MRSA): SAA6159_01482Help
Entry
SAA6159_01482     CDS       T01870                                 

Gene name
glcK
Definition
(GenBank) putative glucokinase, ROK family
  KO
K00845  glucokinase [EC:2.7.1.2]
Organism
suj  Staphylococcus aureus subsp. aureus JKD6159 (CA-MRSA)
Pathway
suj00010  Glycolysis / Gluconeogenesis
suj00052  Galactose metabolism
suj00500  Starch and sucrose metabolism
suj00520  Amino sugar and nucleotide sugar metabolism
suj00521  Streptomycin biosynthesis
suj01100  Metabolic pathways
suj01110  Biosynthesis of secondary metabolites
suj01120  Microbial metabolism in diverse environments
suj01130  Biosynthesis of antibiotics
suj01200  Carbon metabolism
Module
suj_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
suj_M00549  Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:suj00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    SAA6159_01482 (glcK)
   00052 Galactose metabolism
    SAA6159_01482 (glcK)
   00500 Starch and sucrose metabolism
    SAA6159_01482 (glcK)
   00520 Amino sugar and nucleotide sugar metabolism
    SAA6159_01482 (glcK)
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    SAA6159_01482 (glcK)
   00524 Neomycin, kanamycin and gentamicin biosynthesis
    SAA6159_01482 (glcK)
Enzymes [BR:suj01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     SAA6159_01482 (glcK)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ROK Glucokinase
Motif
Other DBs
NCBI-ProteinID: ADL23416
Position
complement(1618451..1619437)
Genome map
AA seq 328 aa AA seqDB search
MTKIILAADVGGTTCKLGIFTPELEQLHKWSIHTDTSDSTGFTLLKGIYDSFVEKVNENN
YNFSNVLGVGIGVPGPVDFEKGTVNGAVNLYWPEKVNVREIFEQFVDCPVYVDNDANIAA
LGEKHKGAGEGADDVVAITLGTGLGGGIISNGEIVHGHNGSGAEIGHFRADFDQRFKCNC
GRSGCIETVASATGVVNLVDFYYPKLTFRSSILELIKENKVTAKAVFDAAKAGDQFCIFI
TEKVANYIGYLCSIISVTSNPKYIVLGGGMSTAGPILIENIKTEYHNLTFTPAQFETEIV
QAKLGNDAGITGAAGLIKTYVLDKEGVK
NT seq 987 nt NT seq  +upstreamnt  +downstreamnt
atgacaaaaattattttagcagctgatgtaggcgggacgacttgtaaattaggtattttc
acacctgaattagaacaattacataaatggtctattcacactgatacatctgatagtaca
ggatttacacttttgaaaggaatttatgattcgtttgttgaaaaagtaaatgaaaataat
tataatttttcaaatgtacttggcgtaggtattggtgtaccaggtcctgttgactttgaa
aaaggtacagtaaatggagcagtaaacttatattggccagaaaaagttaatgtacgtgag
atttttgaacaattcgttgattgtccagtgtatgtagataatgatgctaacatagctgct
ttaggggagaaacacaaaggtgctggtgaaggtgccgatgatgttgttgccatcacactt
ggtacaggactgggtggaggaattatttcaaatggtgaaatcgtacatggtcataatggc
tctggcgcagaaataggtcattttagagcagacttcgatcaacgatttaaatgtaattgt
ggtcgttctggatgtattgaaacagttgcttcagcgacaggcgttgttaacttagtcgac
ttctactatccgaagttgacgtttagatcttctatattagaattgattaaagaaaataag
gttacagcaaaagctgtttttgatgcggcaaaagctggtgaccaattctgtattttcatt
actgaaaaggttgcaaactatattggatatttatgtagtattattagtgttacaagtaat
ccgaaatatatcgttctaggtggaggaatgtctactgcaggacctattttaattgaaaat
attaaaacagaatatcataatttaacatttacacctgctcaatttgaaactgaaattgta
caagcgaaattaggtaatgatgcaggtattacaggagcagcaggattaatcaagacctat
gtattagataaagagggggtaaaataa

DBGET integrated database retrieval system