KEGG   Staphylococcus aureus subsp. aureus JKD6159: SAA6159_01941Help
Entry
SAA6159_01941     CDS       T01870                                 

Gene name
argE
Definition
succinyl-diaminopimelate desuccinylase
Orthology
K01439  
succinyl-diaminopimelate desuccinylase [EC:3.5.1.18]
Organism
suj  Staphylococcus aureus subsp. aureus JKD6159
Pathway
Lysine biosynthesis
Metabolic pathways
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:suj00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    SAA6159_01941 (argE)
  Amino acid metabolism
   00300 Lysine biosynthesis
    SAA6159_01941 (argE)
Enzymes [BR:suj01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.18  succinyl-diaminopimelate desuccinylase
     SAA6159_01941 (argE)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2083444..2084667
Genome map
AA seq 407 aa AA seqDB search
MTTFSEKEKVQLLADIVELQTENNNEIDVCNYLKNLFDKYNIKSEILKVNEHRANIVAEI
GYGSPILALSGHMDVVDAGNHDNWSYPPFQLTEKDGKLYGRGTTDMKGGLMALVVSLIEL
KEQNELPHGTIRLLATAGEEKEQEGAKLLADKGYLDDVDGLIIAEPTGSGIYYAHKGSMS
CKVTATGKAVHSSVPFIGDNAIDTLLEFYNLFKEKYSELKKQDTKHELDVAPMFKSLIGK
EISEEDANYASGLTAVCSIINGGKQFNSVPDEASLEFNVRPVPEYDNDFIEPFFQNIIND
VDSQKLSLDIPSNHRPVTSDKNSKLITTIKDVASSYVDKDDIFVSALVGATDASSFLGDN
KDNVDLAIFGPGNPLMAHQIDEYIEKDMYLKYIDIFKEASIKYLKEK
NT seq 1224 nt NT seq  +upstreamnt  +downstreamnt
atgacaacttttagcgaaaaagaaaaagttcaattactagcagatattgttgaactacaa
actgaaaataataatgaaattgacgtttgtaattatttaaaaaatttattcgacaagtac
aatattaaatctgaaattttgaaagttaatgaacaccgcgccaatatcgttgcagaaatc
ggttacggctcacctatactcgcattgagtggtcatatggatgttgttgatgcaggaaat
cacgataattggtcatatcccccttttcaactgacagaaaaagatggcaaattatatggc
cgaggcactacagatatgaaaggcggtttaatggctttggtcgtatctctaatcgaatta
aaagaacaaaatgaattgcctcatggaacgattagattactggctactgctggcgaagag
aaagaacaagaaggtgccaaattattagctgataaaggctatttagacgatgtcgatggc
ttaattattgctgaaccaactggatctggaatttattatgcacataaggggtctatgtca
tgtaaagtaactgcaactggtaaagctgtccatagctcagttccatttattggtgacaat
gcaattgatacactgcttgaattttataatctatttaaagaaaaatattcagagcttaaa
aaacaagatactaaacatgaattagatgttgcgcctatgttcaaatcattgattggaaaa
gaaatttctgaagaggatgcaaattatgcatctggtcttacagctgtatgttcgattata
aatggtggcaaacaatttaactctgtaccagatgaagcttcacttgaatttaacgtaaga
ccagttcctgagtatgataacgactttatagaaccgtttttccaaaatatcattaatgat
gtggatagccaaaagctttcactcgatattccaagcaatcaccgacctgtaacaagcgat
aaaaatagcaaattaattactacgattaaagatgtagcttctagttatgtagacaaagac
gatatatttgtttcggcgcttgtaggtgcaacagatgcctctagtttcttaggtgataat
aaggacaatgttgatttagccatttttggaccaggtaatccattaatggcacatcaaatc
gatgaatatattgaaaaagatatgtatctgaaatatattgatatttttaaagaggcttcc
attaaatatttaaaagagaaataa

DBGET integrated database retrieval system