KEGG   Staphylococcus aureus subsp. aureus JKD6159: SAA6159_02394Help
Entry
SAA6159_02394     CDS       T01870                                 

Gene name
galU
Definition
UTP--glucose-1-phosphate uridylyltransferase subunit GalU
Orthology
K00963  
UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
suj  Staphylococcus aureus subsp. aureus JKD6159
Pathway
Pentose and glucuronate interconversions
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:suj00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    SAA6159_02394 (galU)
   00052 Galactose metabolism
    SAA6159_02394 (galU)
   00500 Starch and sucrose metabolism
    SAA6159_02394 (galU)
   00520 Amino sugar and nucleotide sugar metabolism
    SAA6159_02394 (galU)
Enzymes [BR:suj01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     SAA6159_02394 (galU)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2568607..2569473)
Genome map
AA seq 288 aa AA seqDB search
MKKIKKAIIPAAGLGTRFLPATKAMPKEMLPILDKPTIQYIVEEAARAGIEDIIIVTGRH
KRAIEDHFDSQKELEMVLKEKGKSELLEKVQYSTELANIFYVRQKEQKGLGHAISSARQF
IGNEPFAVLLGDDIVESEVPAVKQLIDVYEETGHSVIGVQEVPEADTHRYGIIDPLTKNG
RQYEVKKFVEKPSQGTAPSNLAIMGRYVLTPEIFDYLKTQKEGAGNEIQLTDAIERMNND
NQVYAYDFEGERYDVGEKLGFVKTTIEYALKDDSMREELTRFIKELGL
NT seq 867 nt NT seq  +upstreamnt  +downstreamnt
ttgaaaaaaataaaaaaggcaatcattcccgctgctggtttagggactagatttttacca
gcaactaaagcgatgccaaaggaaatgcttcctatcttagataaacccacaatacaatat
atcgttgaagaagctgcaagagctggaattgaagatattattatagtgacaggtcgccac
aaacgcgcgattgaagatcattttgatagtcaaaaagaattagaaatggttttaaaagaa
aaaggtaaatctgaattactagaaaaagttcagtattcaacagaacttgcgaatattttt
tatgtaaggcagaaagaacaaaaaggtttagggcatgcgattagttctgcgcgtcaattt
atcggcaatgaaccatttgcggtattattaggtgatgatattgttgaatctgaagtgcca
gcagtgaaacagttgattgatgtttatgaagaaacggggcactcagttataggtgtccaa
gaagttccggaagcagatactcatcgttatggaattattgatccattaactaaaaatgga
cgtcagtatgaagtgaaaaagtttgttgaaaagccatcacaaggtacggcaccatcaaac
ctagctattatgggccgatatgtattaacgcctgaaattttcgattatttaaaaacgcaa
aaagaaggcgcaggtaacgaaattcagttaacagatgcgattgagcgtatgaataatgat
aaccaagtgtatgcatatgacttcgaaggcgaacgttatgacgttggagaaaaattaggc
ttcgttaaaactaccatagaatatgcgttgaaagatgacagtatgcgagaagaattaaca
cgatttattaaagaattaggtttataa

DBGET integrated database retrieval system