KEGG   Staphylococcus aureus subsp. aureus JKD6159 (CA-MRSA): SAA6159_02412Help
Entry
SAA6159_02412     CDS       T01870                                 

Gene name
fbp
Definition
(GenBank) fructose-1,6-bisphosphatase
  KO
K04041  fructose-1,6-bisphosphatase III [EC:3.1.3.11]
Organism
suj  Staphylococcus aureus subsp. aureus JKD6159 (CA-MRSA)
Pathway
suj00010  Glycolysis / Gluconeogenesis
suj00030  Pentose phosphate pathway
suj00051  Fructose and mannose metabolism
suj00680  Methane metabolism
suj01100  Metabolic pathways
suj01110  Biosynthesis of secondary metabolites
suj01120  Microbial metabolism in diverse environments
suj01130  Biosynthesis of antibiotics
suj01200  Carbon metabolism
Module
suj_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:suj00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    SAA6159_02412 (fbp)
   00030 Pentose phosphate pathway
    SAA6159_02412 (fbp)
   00051 Fructose and mannose metabolism
    SAA6159_02412 (fbp)
  Energy metabolism
   00680 Methane metabolism
    SAA6159_02412 (fbp)
Enzymes [BR:suj01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.11  fructose-bisphosphatase
     SAA6159_02412 (fbp)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FBPase_2 GP24_25
Motif
Other DBs
NCBI-ProteinID: ADL24329
Position
2592093..2594057
Genome map
AA seq 654 aa AA seqDB search
MTQITEKELKKKYLDLLSQNFDTPEKLATEIINLESILELPKGTEHFVSDLHGEYEAFQH
VLRNGSGNVRAKINDIFKERLSTKELNDLTALVYYPEDKLKLIKSDFQSCGQLNVWYITT
IEHLIELIKYCSSKYTRSKLRKALPKQYVYIIEELLYKSNEYQNKKSYYETLVNQVIELK
QADDLIIGLAYSVQRLVVDHLHVVGDIYDRGPQPDKIMDTLINYHSLDIQWGNHDVLWVG
AYAGSKVCLANLLRICARYDNLDIIEDAYGINLRPLLTLAEKYYDADNPAFKPKKRPDKH
ERLTQREESQITKIHQAIAMIQFKLEIPIIKRRPNFEMEERLVLEKVNYDTNEITVYGNT
YPLKDTCFQTVNRDNPAELLPEEEEVMNKLLLSFQQSEKLRRHMSFLMRKGSLYLPYNGN
LLIHGCIPVDENGEMESFEIDGHTYSGQELLDVFEYHVRKSFDEKENTDDLSTDLVWYLW
TGKYSSLFGKRAMTTFERYFIADKASHKEEKNPYYHLREDVNMVRKMLSDFGLNADEGRI
INGHTPVKEINGEDPIKADGKMLVIDGGFSKAYQSTTGIAGYTLLYNSFGMQLVAHQQFN
AKEKILSEGIDELSIKRVVDKELQRKKIRDTNIGKDLQAQIDILKMLMHDRYLD
NT seq 1965 nt NT seq  +upstreamnt  +downstreamnt
atgactcaaatcactgaaaaagaattaaaaaagaagtatttagatttactatctcaaaat
tttgatactccagaaaaacttgcaactgaaattatcaatttagaatcaattttagaatta
cctaaaggtacggaacatttcgtcagcgatttacatggtgaatatgaagctttccaacac
gtattacgcaacggttctgggaacgtgcgagcgaaaatcaatgatattttcaaagagaga
ctttcaactaaggagcttaatgacttaactgctcttgtctactatccagaagacaaatta
aaattgattaaaagtgatttccaaagttgcggtcaacttaatgtctggtatatcacaaca
atcgaacatttaattgagttgattaaatattgttcttcaaagtatacgcgttctaaactg
cgtaaagcattgccaaagcaatacgtttatattattgaggaactactgtataaaagtaat
gaatatcaaaataaaaaatcatattacgaaacacttgttaaccaagtaattgaacttaaa
caggcagatgatttaattatagggcttgcgtattctgtacaacgcttagtcgtcgatcat
ttacacgttgtcggtgatatttatgatcgtggaccacaaccagataaaattatggataca
ctgattaattatcattccctagatattcaatggggtaatcatgatgtgctttgggttgga
gcctatgctgggtcaaaagtatgcttagcaaacttacttcgaatttgtgcacgttatgat
aatttagatattatcgaagacgcttatggcattaatttaagaccactgcttactttagct
gaaaaatactatgacgcagataatcctgcttttaaacctaaaaaaagacctgacaaacat
gaacgtttaactcaacgtgaagaaagtcaaattactaaaattcatcaagctattgcgatg
attcaattcaagttagaaataccaattattaaacgtcgtccaaatttcgaaatggaagaa
cgtcttgtgcttgaaaaggttaattatgatacaaatgaaattacagtttatggtaataca
tacccgttgaaagacacatgtttccaaactgtcaatcgtgataatccagcagaattacta
cctgaagaagaagaagtcatgaataaactattattgtcattccaacaatctgaaaaatta
cgtcgtcatatgtctttcttgatgcgtaaaggttcgctttacttaccatataatggcaat
ttactcattcatggttgtattccagttgatgaaaatggtgagatggaatcatttgaaatt
gatggtcatacttacagtggccaagaattattagatgtgtttgagtatcatgtccgtaaa
tcatttgatgaaaaagaaaatactgatgacttatcgacggatttagtttggtatttatgg
actgggaaatattcgtcattatttggtaaacgtgccatgacaacgtttgagcgatacttt
attgcagataaagcttctcataaagaagaaaaaaatccatactatcatctacgtgaagat
gtgaatatggttcgtaaaatgctcagtgatttcggattaaatgcagatgaaggtcgtatt
attaatggtcacacaccagtgaaagaaatcaatggcgaagatcctatcaaggctgatgga
aagatgcttgtcattgatggtggcttttcaaaagcttatcagtcaacaactggcattgca
ggctatacactattgtataattcattcggtatgcaactcgttgcacaccaacaatttaac
gctaaagaaaaaatactttccgaaggtatcgatgaactttctataaagcgcgtcgtagat
aaagaattacaacgtaagaagattcgtgataccaatattggtaaagatcttcaagctcaa
atagatattttaaaaatgttaatgcatgatcgttacttggactaa

DBGET integrated database retrieval system