KEGG   Staphylococcus aureus subsp. aureus JKD6159 (CA-MRSA): SAA6159_02505Help
Entry
SAA6159_02505     CDS       T01870                                 

Gene name
acsA2
Definition
(GenBank) AMP-dependent synthetase and ligase
  KO
K01895  acetyl-CoA synthetase [EC:6.2.1.1]
Organism
suj  Staphylococcus aureus subsp. aureus JKD6159 (CA-MRSA)
Pathway
suj00010  Glycolysis / Gluconeogenesis
suj00620  Pyruvate metabolism
suj00640  Propanoate metabolism
suj00680  Methane metabolism
suj01100  Metabolic pathways
suj01110  Biosynthesis of secondary metabolites
suj01120  Microbial metabolism in diverse environments
suj01130  Biosynthesis of antibiotics
suj01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:suj00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    SAA6159_02505 (acsA2)
   00620 Pyruvate metabolism
    SAA6159_02505 (acsA2)
   00640 Propanoate metabolism
    SAA6159_02505 (acsA2)
  Energy metabolism
   00680 Methane metabolism
    SAA6159_02505 (acsA2)
Enzymes [BR:suj01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.1  acetate---CoA ligase
     SAA6159_02505 (acsA2)
Lipid biosynthesis proteins [BR:suj01004]
 Acyl-CoA synthetase
  Short/medium chain acyl-CoA synthetase
   SAA6159_02505 (acsA2)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AMP-binding AMP-binding_C Atu4866
Motif
Other DBs
NCBI-ProteinID: ADL24419
Position
complement(2687692..2689290)
Genome map
AA seq 532 aa AA seqDB search
MQKSALFAPEKYNIISEIEKYSHIPDKKAILYHNTEGEDISVTYQQLIEQSNKVGNVLAS
HGLSKGDKVLIMMPRSIATYELYIAALKLGVAIIPCSEMLRTKDLQYRITHGEINAVIAL
EPFTVEFEKIKEYDALTKFVIAGQKDGWISLEAEKENASNKLEMADTTRDDMAILSYTSG
TTGNPKAVTHCHGWGFAHLQMAPKHWLCINEDDLVWATAAPGWQKWVWSPFLSVLGSGAT
AFVFNGRFSPETYLELLQKYQINVLCCTPTEYRMMAKLQNLNDYDLTHLHSAVSAGEPLN
REVVEQFKKYFNLTVRDGYGQTESTLLIGFLKDTPQRIGSMGKGIPGSSVTVVDDEGNSV
PANTKGNIAVPLDLPALFKGYYKEPERTAKAQTGKYYITGDLAHVDDDGYFWFEGRRDDI
IISSGYTIGPFEVEDALTNHPAVKECAVVAKPHDIRGNIVKAFVILQDHTAGDDTLVKEL
QQFVKNEVAPYKYPREIEFVDDLPKTNSGKIRRVELRDAEIEKWQQQKDSNQ
NT seq 1599 nt NT seq  +upstreamnt  +downstreamnt
atgcaaaagtcagctctattcgcgcctgaaaaatataacattatttcggaaatcgaaaaa
tatagccacataccagataaaaaggcaattctatatcataatactgaaggcgaagatata
tcagtcacttaccaacagctcattgaacagtctaataaagtaggtaatgttttagcatcg
cacggtttatctaaaggcgataaagtactcattatgatgccacgatctattgcgacatat
gaattatatattgctgctttaaaattaggtgttgcaatcattccgtgttctgaaatgcta
agaactaaagatttacaataccgtatcacacacggtgaaataaatgcagtcattgcatta
gagccattcacagttgaatttgaaaaaattaaagaatatgatgcgttaactaaatttgtt
attgccggtcaaaaagatggatggatttcacttgaagctgaaaaagaaaacgcaagtaac
aaactagaaatggcagatacgacgcgtgatgatatggcgattctgtcatatacatctggt
acaactggcaatcctaaagccgttacacattgtcatggatggggatttgcacatttacaa
atggcaccaaaacattggttatgtattaatgaagatgacttagtttgggcaacagcagca
ccaggttggcaaaaatgggtatggagtcctttcttatctgtattaggttcaggtgcaact
gcttttgtatttaatggaagattcagccctgaaacatacttagaattgcttcaaaaatat
caaattaatgttttatgttgtacaccgacagaatatcgtatgatggctaaattacagaac
ttaaatgattatgacttaacgcatttacatagtgccgtttctgcaggtgagccactaaat
cgagaagtagttgaacaattcaagaaatactttaatttaactgtaagagatggatatggc
cagactgaaagtaccttgcttataggctttttaaaagatacaccacaaaggattggatca
atgggtaaaggcattccgggtagttcggtcactgtagtagatgatgaggggaatagcgta
cctgctaatacgaaagggaatattgcagtaccacttgatttgccagcacttttcaaaggg
tattataaagagccagaacgtacggcgaaagcgcaaacaggtaaatactacatcactggt
gacttagctcatgtagatgatgatggttatttctggtttgaaggacgtcgagatgacatt
attattagttcaggctatacgattgggccttttgaagttgaagatgcgttaacgaatcat
ccagccgttaaagaatgtgctgtagtagcaaaacctcatgatatacgaggaaatattgtt
aaagcattcgttattttacaggaccatactgcgggtgatgatacgctagttaaagaacta
caacaatttgttaaaaatgaagttgcaccatataaatatccgagagagattgaattcgtt
gacgacttaccaaaaacaaactcaggtaaaattcgtcgtgttgaactacgagatgctgaa
atagaaaaatggcaacaacaaaaagatagcaatcaataa

DBGET integrated database retrieval system