KEGG   Staphylococcus aureus subsp. aureus JKD6008 (MRSA/VISA): SAA6008_00376Help
Entry
SAA6008_00376     CDS       T01886                                 

Definition
putative phosphoglycerate mutase family protein
Orthology
K01834  
2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Organism
suk  Staphylococcus aureus subsp. aureus JKD6008 (MRSA/VISA)
Pathway
Glycolysis / Gluconeogenesis
Glycine, serine and threonine metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:suk00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    SAA6008_00376
   01230 Biosynthesis of amino acids
    SAA6008_00376
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    SAA6008_00376
  Energy metabolism
   00680 Methane metabolism
    SAA6008_00376
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    SAA6008_00376
Enzymes [BR:suk01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.11  phosphoglycerate mutase (2,3-diphosphoglycerate-dependent)
     SAA6008_00376
Exosome [BR:suk04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   SAA6008_00376
  Exosomal proteins of melanoma cells
   SAA6008_00376
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
410960..411541
Genome map
AA seq 193 aa AA seqDB search
MTIYLVRHGESKSNYDNKHFRSYFCGQLDVPLTDTGTKSADDLCDYFKEKQIKHVYVSDL
LRTQQTFEHIFPYDIASTTTPLLRERSLGVFEGEYKDEISANPKYEKYFNDPNFKDFRHS
FSQKAPEGESYEDVYQRVEHFMNHVVNEDTQKDDIVIVAHQVVIRCLMVYFNKVSRAEAV
DLKVENCKPYIIE
NT seq 582 nt NT seq  +upstreamnt  +downstreamnt
atgacgatttatttagttagacatggcgaatcaaaatcgaattatgataataaacatttt
cgatcttatttttgtggacaattagatgtgccgttaacggatactggcacaaaaagtgca
gacgatttatgtgattattttaaagagaaacagattaaacatgtatatgtttcagactta
ttaagaacacagcaaacgtttgaacatatttttccatatgacattgcatcaacgactacc
cctctattaagagaacgttcacttggcgtatttgagggtgaatataaagatgaaatcagt
gcgaatccgaaatatgaaaaatatttcaatgatccaaactttaaagactttcgtcatagt
ttttcacaaaaagcgcctgaaggagaaagttatgaagatgtatatcaacgcgtagaacat
tttatgaatcatgttgtcaatgaagatacacaaaaagatgatattgtcattgttgcacat
caagttgtcattcgttgtttgatggtttattttaacaaagtttcaagggcagaagctgtg
gatttaaaggtagaaaattgcaaaccatatatcattgaatag

DBGET integrated database retrieval system