KEGG   Staphylococcus aureus subsp. aureus JKD6008 (MRSA/VISA): SAA6008_00460Help
Entry
SAA6008_00460     CDS       T01886                                 

Definition
esterase/lipase
Orthology
K03928  
carboxylesterase [EC:3.1.1.1]
Organism
suk  Staphylococcus aureus subsp. aureus JKD6008 (MRSA/VISA)
Brite
Enzymes [BR:suk01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.1  carboxylesterase
     SAA6008_00460
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
496516..497250
Genome map
AA seq 244 aa AA seqDB search
MRIKTPSPSYLKGTNGHAILLLHSFTGTNRDVKHLAAELNDQGFSCYAPNYPGHGLLLKD
FMTYNVDDWWEEVEKAYQFLVNEGYESISATGVSLGGLMTLKLAQHYPLKRIAVMSAPKE
KSDDGLIEHLVYYSQRMSNILNLDQQASSAQLAAIDDYEGEITKFQHFIDDIMTNLNVIK
MPANILFGGKDAPSYETSAHFIYEHLGSVDKELNGLKDSHHLMTHGEGRDILEENVIRFF
NALT
NT seq 735 nt NT seq  +upstreamnt  +downstreamnt
atgagaattaaaacaccgagtccatcgtatttaaaaggcacaaatggacatgcgatatta
ttattacattcatttacaggtacaaatcgggatgtgaagcatcttgcagctgagttaaat
gaccaaggatttagttgttatgcaccgaattatccaggtcatggtttattgttgaaagat
ttcatgacatataatgtagatgattggtgggaagaagttgagaaagcttaccaattttta
gtcaatgaaggttatgaatctatcagtgcaacgggtgtgtctttaggtggattaatgaca
ttaaaattggcgcaacactatcctttgaaacgtatcgctgtcatgtcagcaccaaaggaa
aagagtgacgatggcttaatagaacatttagtttattatagtcaacgcatgtcgaatatt
ttaaatttagatcagcaagcatcgagtgcgcaattagcagcaattgatgattatgaaggt
gaaattacgaagtttcaacattttattgatgatatcatgacaaatttaaatgttattaaa
atgccagctaatatattatttggtggtaaagatgcgccatcctatgaaacaagtgcacat
tttatttatgaacatttaggatcagtagacaaagaattaaatggtctgaaggattcgcat
catttaatgacgcatggagaaggcagagatattttagaagaaaatgttattcgctttttc
aatgctttaacataa

DBGET integrated database retrieval system