KEGG   Staphylococcus aureus subsp. aureus JKD6008 (MRSA/VISA): SAA6008_00484Help
Entry
SAA6008_00484     CDS       T01886                                 

Gene name
recR
Definition
putative recombination protein
Orthology
K06187  
recombination protein RecR
Organism
suk  Staphylococcus aureus subsp. aureus JKD6008 (MRSA/VISA)
Pathway
Homologous recombination
Class
Genetic Information Processing; Replication and repair; Homologous recombination [PATH:suk03440]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
524256..524852
Genome map
AA seq 198 aa AA seqDB search
MHYPEPISKLIDSFMKLPGIGPKTAQRLAFHTLDMKEDDVVQFAKALVDVKRELTYCSVC
GHITENDPCYICEDKQRDRSVICVVEDDKDVIAMEKMREYKGLYHVLHGSISPMDGIGPE
DINIPSLIERLKNDEVSELILAMNPNLEGESTAMYISRLVKPIGIKVTRLAQGLSVGGDL
EYADEVTLSKAIAGRTEM
NT seq 597 nt NT seq  +upstreamnt  +downstreamnt
atgcattatccagaacctatatcaaaacttattgatagctttatgaaattgccaggcatt
ggtccaaagacagcccaacgtctggcttttcataccttagatatgaaagaagacgatgtt
gttcagtttgccaaagcattagtagatgttaagagagaattaacatattgtagcgtatgt
ggtcacattactgaaaatgatccatgttatatttgtgaagataagcaaagagatcgttca
gttatttgtgttgtggaagatgacaaagatgtcatagctatggaaaaaatgagagaatac
aaaggtttatatcacgttttacatgggtctatttcgcctatggatggcattggaccagaa
gatattaatattccttcattgattgaacgcttgaaaaacgatgaagttagcgaattaatc
ttagctatgaacccgaacttagagggggaatctacagccatgtatatttctagattagtt
aagcctataggtatcaaagtgacgagattagcacaagggttatcggtaggtggcgattta
gagtatgctgacgaagtaacattatctaaagcaatcgcaggtagaacagaaatgtaa

DBGET integrated database retrieval system