KEGG   Staphylococcus aureus subsp. aureus JKD6008 (MRSA/VISA): SAA6008_00519Help
Entry
SAA6008_00519     CDS       T01886                                 

Gene name
folP
Definition
dihydropteroate synthase chain A synthetase
Orthology
K00796  
dihydropteroate synthase [EC:2.5.1.15]
Organism
suk  Staphylococcus aureus subsp. aureus JKD6008 (MRSA/VISA)
Pathway
Folate biosynthesis
Metabolic pathways
Module
Tetrahydrofolate biosynthesis, GTP => THF
Brite
KEGG Orthology (KO) [BR:suk00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    SAA6008_00519 (folP)
Enzymes [BR:suk01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.15  dihydropteroate synthase
     SAA6008_00519 (folP)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
564808..565617
Genome map
AA seq 269 aa AA seqDB search
MTKTKIMGILNVTPDSLSDGGKFNNVESAINRVKAMIDEGADIIDVGGVSTRPGHEMVSL
EEEMNRVLPVVEAIVGFDVKISVDTFRSEVAEACLKLGVDMINDQWAGLYDHRMFQIVAK
YDAEIILMHNGNGNRDEPVVEEMLTSLLAQAHQAKIAGIPSNKIWLDPGIGFAKTRNEEA
EVMARLDELVATEYPVLLATSRKRFTKEMMGYDTTPVERDEVTAATTAYGIMKGVRAVRV
HNVELNAKLAKGIDFLKEKENENARHNLS
NT seq 810 nt NT seq  +upstreamnt  +downstreamnt
atgactaaaacaaaaattatgggcatattaaacgtcacacctgattcactctcagatggt
ggaaaatttaataatgttgaatcagctataaatagagtgaaagccatgatagatgaaggt
gctgacattatagatgttggaggtgtttcaacgagacccggtcatgaaatggtttcatta
gaagaagagatgaacagagtattacctgttgttgaagctattgtcggttttgatgtaaaa
atttcagtcgatacatttcgaagtgaggttgctgaagcatgtttaaaattaggcgttgat
atgattaatgatcaatgggcgggtctgtatgatcatcgtatgttccaaattgtagctaaa
tatgacgcggaaattattttaatgcataatggaaatggtaatcgtgatgaaccggttgtc
gaagaaatgttaacatctttgttagcacaagcacatcaagctaaaatagctggtatacct
tcaaataaaatttggctagatccaggtataggtttcgctaaaactagaaatgaagaagcc
gaagttatggcaagactggatgaacttgttgcaacagaatatccagttttattagcgaca
agccggaaacgtttcactaaagagatgatgggttatgatacaacaccggttgaaagagat
gaagtaactgcagctacgactgcatatggtattatgaaaggcgttagagcagtacgcgtt
cataatgtcgagttgaatgctaaattagctaaaggtatagattttttaaaggagaaggag
aatgaaaatgcaagacacaatctttcttaa

DBGET integrated database retrieval system