KEGG   Staphylococcus aureus subsp. aureus JKD6008 (MRSA/VISA): SAA6008_00534Help
Entry
SAA6008_00534     CDS       T01886                                 

Gene name
gltX
Definition
putative glutamyl-tRNA synthetase
Orthology
K09698  
nondiscriminating glutamyl-tRNA synthetase [EC:6.1.1.24]
Organism
suk  Staphylococcus aureus subsp. aureus JKD6008 (MRSA/VISA)
Pathway
Aminoacyl-tRNA biosynthesis
Metabolic pathways
Module
Aminoacyl-tRNA biosynthesis, prokaryotes
Class
Genetic Information Processing; Translation; Aminoacyl-tRNA biosynthesis [PATH:suk00970]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
588051..589505
Genome map
AA seq 484 aa AA seqDB search
MSDRIRVRYAPSPTGYLHIGNARTALFNYLYAKHYNGDFVIRIEDTDKKRNLEDGETSQF
DNLKWLGLDWDESVDKDNGYGPYRQSERQHIYQPLIDQLLAEDKAYKCYMTEEELEAERE
AQIARGEMPRYGGQHAHLTEEQRQQFEAEGRQPSIRFRVPQNQTYSFDDMVKGNISFDSN
GIGDWVIVKKDGIPTYNFAVAIDDHYMQISDVIRGDDHISNTPKQIMIYEAFGWEPPRFG
HMSLIVNEERKKLSKRDGQILQFIEQYRDLGYLPEALFNFIALLGWSPEGEEEIFSKEEF
IKIFDEKRLSKSPAFFDKQKLAWVNNQYMKQKDTETVFQLALPHLIKANLIPEVPSEEDL
SWGRKLIALYQKEMSYAGEIVPLSEMFFKEMPALGEEEQQVINGEQVPELMTHLFSKLEA
LEPFEAAEIKKTIKEVQKETGIKGKQLFMPIRVAVTGQMHGPELPNTIEVLGKEKVLNRL
KQYK
NT seq 1455 nt NT seq  +upstreamnt  +downstreamnt
atgagcgatcgtataagagtaagatatgcaccaagtccaactgggtatcttcatattggt
aatgcaagaacagcattattcaattacttgtatgctaaacattacaacggagattttgtg
attcgaattgaagatactgataaaaaacgtaatttagaagatggagaaacatcacaattt
gataatcttaaatggttaggattagattgggatgagtctgtagataaagacaatggctac
ggaccatatcgtcaatctgaacgtcaacatatctaccaaccattaatagatcagttacta
gcagaagataaagcatataaatgctatatgacagaagaagaattagaagctgaacgtgaa
gcgcaaatcgctcgtggtgaaatgcctcgctatggtggtcaacatgcgcatttgactgaa
gaacaacgtcaacaatttgaagcagaaggacgccaaccatcaattcgtttccgagtacct
caaaaccaaacgtattcatttgatgatatggtaaaaggaaatatttcatttgattcaaat
ggtattggtgactgggttatcgtaaaaaaagatggcattccaacgtacaattttgcagta
gctatagatgatcattacatgcaaatttcagatgtaattcgtggtgatgatcatatttca
aacacgcctaaacaaattatgatttatgaagcatttggctgggagccacctcgttttggt
catatgtcattaattgttaatgaagaacgtaaaaagttaagtaaacgtgatgggcaaatt
ttacaatttattgagcaatatcgtgacttaggttatttacctgaagcgttatttaatttt
attgcgttattaggttggtctcctgaaggtgaagaagaaatcttttctaaagaagaattt
atcaaaatctttgatgaaaagcgtttgtcaaaatcaccagcatttttcgataagcaaaaa
ttagcatgggttaataaccaatatatgaaacaaaaagatactgaaacagtattccaatta
gcattacctcatttaattaaagcaaatttgattcctgaggtgccgtcagaagaggattta
tcttggggacgcaaattaattgcgctttatcaaaaagaaatgagttatgccggtgaaatt
gtacctttatcagaaatgttctttaaagaaatgccagctcttggtgaagaagaacaacaa
gtgattaatggagagcaagtaccagagttaatgacgcacttattcagtaaattagaagca
cttgaaccatttgaagcggctgaaattaaaaagacaattaaagaagttcaaaaagaaaca
ggaataaaaggcaagcaattatttatgcctattcgtgttgctgtaacaggccaaatgcat
ggtcctgaattaccaaatacaattgaagtacttggtaaagaaaaagtgctaaaccgttta
aaacaatataagtaa

DBGET integrated database retrieval system