KEGG   Staphylococcus aureus subsp. aureus JKD6008 (MRSA/VISA): SAA6008_00583Help
Entry
SAA6008_00583     CDS       T01886                                 

Gene name
vraB
Definition
(GenBank) acetyl-CoA C-acetyltransferase VraB
  KO
K00626  
acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
suk  Staphylococcus aureus subsp. aureus JKD6008 (MRSA/VISA)
Pathway
Fatty acid degradation
Synthesis and degradation of ketone bodies
Valine, leucine and isoleucine degradation
Lysine degradation
Benzoate degradation
Tryptophan metabolism
Pyruvate metabolism
Glyoxylate and dicarboxylate metabolism
Propanoate metabolism
Butanoate metabolism
Terpenoid backbone biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Fatty acid metabolism
Two-component system
Brite
KEGG Orthology (KO) [BR:suk00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    SAA6008_00583 (vraB)
   00630 Glyoxylate and dicarboxylate metabolism
    SAA6008_00583 (vraB)
   00640 Propanoate metabolism
    SAA6008_00583 (vraB)
   00650 Butanoate metabolism
    SAA6008_00583 (vraB)
  Lipid metabolism
   00071 Fatty acid degradation
    SAA6008_00583 (vraB)
   00072 Synthesis and degradation of ketone bodies
    SAA6008_00583 (vraB)
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    SAA6008_00583 (vraB)
   00310 Lysine degradation
    SAA6008_00583 (vraB)
   00380 Tryptophan metabolism
    SAA6008_00583 (vraB)
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    SAA6008_00583 (vraB)
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    SAA6008_00583 (vraB)
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    SAA6008_00583 (vraB)
Enzymes [BR:suk01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     SAA6008_00583 (vraB)
Exosome [BR:suk04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   SAA6008_00583 (vraB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
Position
647964..649103
Genome map
AA seq 379 aa AA seqDB search
MNQAVIVAAKRTAFGKYGGTLKHLEPEQLLKPLFQHFKEKYPEVISKIDDVVLGNVVGNG
GNIARKALLEAGLKDSIPGVTIDRQCGSGLESVQYACRMIQAGAGKVYIAGGVESTSRAP
WKIKRPHSVYETALPEFYERASFAPEMSDPSMIQGAENVAKMYDVSRELQDEFAYRSHQL
TAENVKNGNISQEILPITVKGEIFNTDESLKSHIPKDNFGRFKPVIKGGTVTAANSCMKN
DGAVLLLIMEKDMAYELGFEHGLLFKDGVTVGVDSNFPGIGPVPAISNLLKRNQLTIENI
EVIEINEEFSAQVVACQQALNISNTQLNIWGGALASGHPYGASGAQLVTRLFYMFDKETM
IASMGIGGGLGNAALFTRF
NT seq 1140 nt NT seq  +upstreamnt  +downstreamnt
atgaatcaagcagtcatagttgcagctaaacgaactgcatttgggaaatatggtggcact
ttaaaacatttagagccagaacaattgcttaaacctttattccaacattttaaagagaag
tatccagaggtaatatctaaaatagatgatgtagttttaggtaatgttgttgggaatggt
ggcaatattgcaagaaaagcattgcttgaagcggggcttaaagattcaatacctggcgtc
acaatcgatcggcaatgtgggtctggacttgaaagtgttcaatatgcatgtcgcatgatc
caagccggagctggcaaggtatatattgcaggtggtgttgaaagtacaagtcgagcacct
tggaaaatcaaacgaccgcattctgtgtacgaaacagcattacctgagttttatgagcgt
gcatcatttgcacctgaaatgagcgacccatcaatgattcaaggtgctgaaaatgtggcc
aagatgtatgatgtttcaagagaattacaagatgaatttgcttatcgaagtcatcaattg
acagcggaaaatgtaaagaatggaaatatttctcaggaaatattacctataaccgttaaa
ggagaaatattcaacactgatgaaagtctaaaatcacatattccgaaagataactttggc
cgatttaagcccgtgatcaaaggtgggaccgttaccgctgcgaatagttgtatgaaaaat
gatggtgcagttttattgcttattatggaaaaagatatggcatacgaattaggtttcgag
catggtttattatttaaagatggtgttacggtaggtgttgattctaattttcctggcatt
ggtccagtaccagccatttccaacttactaaaaagaaatcaattaacgatagaaaatatt
gaagtcattgaaattaacgaagagttcagtgcacaggtagttgcctgccaacaagcttta
aatatttcaaatacgcaattaaatatatggggtggtgcattagcatcaggtcatccatac
ggtgcaagcggtgcccaattagtgactcgattattttatatgtttgacaaagagactatg
attgcatctatggggatagggggaggtctaggaaatgcagcattatttactcgattctaa

DBGET integrated database retrieval system