KEGG   Staphylococcus aureus subsp. aureus JKD6008 (MRSA/VISA): SAA6008_00789Help
Entry
SAA6008_00789     CDS       T01886                                 

Gene name
tpi
Definition
triose-phosphate isomerase
Orthology
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
suk  Staphylococcus aureus subsp. aureus JKD6008 (MRSA/VISA)
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Inositol phosphate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:suk00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    SAA6008_00789 (tpi)
   01230 Biosynthesis of amino acids
    SAA6008_00789 (tpi)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    SAA6008_00789 (tpi)
   00051 Fructose and mannose metabolism
    SAA6008_00789 (tpi)
   00562 Inositol phosphate metabolism
    SAA6008_00789 (tpi)
Enzymes [BR:suk01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     SAA6008_00789 (tpi)
Exosome [BR:suk04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   SAA6008_00789 (tpi)
  Exosomal proteins of bladder cancer cells
   SAA6008_00789 (tpi)
  Exosomal proteins of melanoma cells
   SAA6008_00789 (tpi)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Structure
PDB: 

Jmol
Position
861473..862324
Genome map
AA seq 283 aa AA seqDB search
MFNIVTGKQSQDDIVFHHFSKIFTKQGVSLMRTPIIAGNWKMNKTVQEAKDFVNALPTLP
DSKEVESVICAPAIQLDALTTAVKEGKAQGLEIGAQNTYFEDNGAFTGETSPVALADLGV
KYVVIGHSERRELFHETDEEINKKAHAIFKHGMTPIICVGETDEERESGKANDVVGEQVK
KAVAGLSEDQLKSVVIAYEPIWAIGTGKSSTSEDANEMCAFVRQTIADLSSKEVSEATRI
QYGGSVKPNNIKEYMAQTDIDGALVGGASLKVEDFVQLLEGAK
NT seq 852 nt NT seq  +upstreamnt  +downstreamnt
ttgtttaacattgttacgggaaaacagtcacaagatgacatcgtgtttcatcacttttca
aaaatatttacaaaacaaggagtgtctttaatgagaacaccaattatagctggtaactgg
aaaatgaacaaaacagtacaagaagcaaaagacttcgtcaatgcattaccaacattacca
gattcaaaagaagtagaatcagtaatttgtgcaccagcaattcaattagatgcattaact
actgcagttaaagaaggaaaagcacaaggtttagaaatcggtgctcaaaatacgtatttc
gaagataatggtgcgttcacaggtgaaacgtctccagttgcattagcagatttaggcgtt
aaatacgttgttatcggtcattctgaacgtcgtgaattattccacgaaacagatgaagaa
attaacaaaaaagcgcacgctattttcaaacatggaatgactccaattatatgtgttggt
gaaacagacgaagagcgtgaaagtggtaaagctaacgatgttgtaggtgagcaagttaag
aaagctgttgcaggtttatctgaagatcaacttaaatcagttgtaattgcttatgaacca
atctgggcaatcggaactggtaaatcatcaacatctgaagatgcaaatgaaatgtgtgca
tttgtacgtcaaactattgctgacttatcaagcaaagaagtatcagaagcaactcgtatt
caatatggtggtagtgttaaacctaacaacattaaagaatacatggcacaaactgatatt
gatggggcattagtaggtggcgcatcacttaaagttgaagatttcgtacaattgttagaa
ggtgcaaaataa

DBGET integrated database retrieval system