KEGG   Staphylococcus aureus subsp. aureus JKD6008 (MRSA/VISA): SAA6008_00789Help
Entry
SAA6008_00789     CDS       T01886                                 

Gene name
tpi
Definition
(RefSeq) triose-phosphate isomerase
  KO
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
suk  Staphylococcus aureus subsp. aureus JKD6008 (MRSA/VISA)
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Inositol phosphate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:suk00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    SAA6008_00789 (tpi)
   01230 Biosynthesis of amino acids
    SAA6008_00789 (tpi)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    SAA6008_00789 (tpi)
   00051 Fructose and mannose metabolism
    SAA6008_00789 (tpi)
   00562 Inositol phosphate metabolism
    SAA6008_00789 (tpi)
Enzymes [BR:suk01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     SAA6008_00789 (tpi)
Exosome [BR:suk04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   SAA6008_00789 (tpi)
  Exosomal proteins of bladder cancer cells
   SAA6008_00789 (tpi)
  Exosomal proteins of melanoma cells
   SAA6008_00789 (tpi)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Structure
PDB: 

Jmol
Position
861473..862324
Genome map
AA seq 283 aa AA seqDB search
MFNIVTGKQSQDDIVFHHFSKIFTKQGVSLMRTPIIAGNWKMNKTVQEAKDFVNALPTLP
DSKEVESVICAPAIQLDALTTAVKEGKAQGLEIGAQNTYFEDNGAFTGETSPVALADLGV
KYVVIGHSERRELFHETDEEINKKAHAIFKHGMTPIICVGETDEERESGKANDVVGEQVK
KAVAGLSEDQLKSVVIAYEPIWAIGTGKSSTSEDANEMCAFVRQTIADLSSKEVSEATRI
QYGGSVKPNNIKEYMAQTDIDGALVGGASLKVEDFVQLLEGAK
NT seq 852 nt NT seq  +upstreamnt  +downstreamnt
ttgtttaacattgttacgggaaaacagtcacaagatgacatcgtgtttcatcacttttca
aaaatatttacaaaacaaggagtgtctttaatgagaacaccaattatagctggtaactgg
aaaatgaacaaaacagtacaagaagcaaaagacttcgtcaatgcattaccaacattacca
gattcaaaagaagtagaatcagtaatttgtgcaccagcaattcaattagatgcattaact
actgcagttaaagaaggaaaagcacaaggtttagaaatcggtgctcaaaatacgtatttc
gaagataatggtgcgttcacaggtgaaacgtctccagttgcattagcagatttaggcgtt
aaatacgttgttatcggtcattctgaacgtcgtgaattattccacgaaacagatgaagaa
attaacaaaaaagcgcacgctattttcaaacatggaatgactccaattatatgtgttggt
gaaacagacgaagagcgtgaaagtggtaaagctaacgatgttgtaggtgagcaagttaag
aaagctgttgcaggtttatctgaagatcaacttaaatcagttgtaattgcttatgaacca
atctgggcaatcggaactggtaaatcatcaacatctgaagatgcaaatgaaatgtgtgca
tttgtacgtcaaactattgctgacttatcaagcaaagaagtatcagaagcaactcgtatt
caatatggtggtagtgttaaacctaacaacattaaagaatacatggcacaaactgatatt
gatggggcattagtaggtggcgcatcacttaaagttgaagatttcgtacaattgttagaa
ggtgcaaaataa

DBGET integrated database retrieval system