KEGG   Staphylococcus aureus subsp. aureus JKD6008 (MRSA/VISA): SAA6008_00789Help
Entry
SAA6008_00789     CDS       T01886                                 

Gene name
tpi
Definition
(GenBank) triose-phosphate isomerase
  KO
K01803  triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
suk  Staphylococcus aureus subsp. aureus JKD6008 (MRSA/VISA)
Pathway
suk00010  Glycolysis / Gluconeogenesis
suk00051  Fructose and mannose metabolism
suk00562  Inositol phosphate metabolism
suk01100  Metabolic pathways
suk01110  Biosynthesis of secondary metabolites
suk01120  Microbial metabolism in diverse environments
suk01130  Biosynthesis of antibiotics
suk01200  Carbon metabolism
suk01230  Biosynthesis of amino acids
Module
suk_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
suk_M00002  Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:suk00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    SAA6008_00789 (tpi)
   00051 Fructose and mannose metabolism
    SAA6008_00789 (tpi)
   00562 Inositol phosphate metabolism
    SAA6008_00789 (tpi)
Enzymes [BR:suk01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     SAA6008_00789 (tpi)
Exosome [BR:suk04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   SAA6008_00789 (tpi)
  Exosomal proteins of bladder cancer cells
   SAA6008_00789 (tpi)
  Exosomal proteins of melanoma cells
   SAA6008_00789 (tpi)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TIM
Motif
Other DBs
NCBI-ProteinID: ADL64848
Structure
PDB: 

Jmol
Position
861473..862324
Genome map
AA seq 283 aa AA seqDB search
MFNIVTGKQSQDDIVFHHFSKIFTKQGVSLMRTPIIAGNWKMNKTVQEAKDFVNALPTLP
DSKEVESVICAPAIQLDALTTAVKEGKAQGLEIGAQNTYFEDNGAFTGETSPVALADLGV
KYVVIGHSERRELFHETDEEINKKAHAIFKHGMTPIICVGETDEERESGKANDVVGEQVK
KAVAGLSEDQLKSVVIAYEPIWAIGTGKSSTSEDANEMCAFVRQTIADLSSKEVSEATRI
QYGGSVKPNNIKEYMAQTDIDGALVGGASLKVEDFVQLLEGAK
NT seq 852 nt NT seq  +upstreamnt  +downstreamnt
ttgtttaacattgttacgggaaaacagtcacaagatgacatcgtgtttcatcacttttca
aaaatatttacaaaacaaggagtgtctttaatgagaacaccaattatagctggtaactgg
aaaatgaacaaaacagtacaagaagcaaaagacttcgtcaatgcattaccaacattacca
gattcaaaagaagtagaatcagtaatttgtgcaccagcaattcaattagatgcattaact
actgcagttaaagaaggaaaagcacaaggtttagaaatcggtgctcaaaatacgtatttc
gaagataatggtgcgttcacaggtgaaacgtctccagttgcattagcagatttaggcgtt
aaatacgttgttatcggtcattctgaacgtcgtgaattattccacgaaacagatgaagaa
attaacaaaaaagcgcacgctattttcaaacatggaatgactccaattatatgtgttggt
gaaacagacgaagagcgtgaaagtggtaaagctaacgatgttgtaggtgagcaagttaag
aaagctgttgcaggtttatctgaagatcaacttaaatcagttgtaattgcttatgaacca
atctgggcaatcggaactggtaaatcatcaacatctgaagatgcaaatgaaatgtgtgca
tttgtacgtcaaactattgctgacttatcaagcaaagaagtatcagaagcaactcgtatt
caatatggtggtagtgttaaacctaacaacattaaagaatacatggcacaaactgatatt
gatggggcattagtaggtggcgcatcacttaaagttgaagatttcgtacaattgttagaa
ggtgcaaaataa

DBGET integrated database retrieval system