KEGG   Staphylococcus aureus subsp. aureus JKD6008 (MRSA/VISA): SAA6008_01505Help
Entry
SAA6008_01505     CDS       T01886                                 

Gene name
gcvPA
Definition
(GenBank) glycine dehydrogenase, subunit 1 (glycine cleavage system P protein)
  KO
K00282  
glycine dehydrogenase subunit 1 [EC:1.4.4.2]
Organism
suk  Staphylococcus aureus subsp. aureus JKD6008 (MRSA/VISA)
Pathway
Glycine, serine and threonine metabolism
Glyoxylate and dicarboxylate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:suk00001]
 Metabolism
  Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    SAA6008_01505 (gcvPA)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    SAA6008_01505 (gcvPA)
Enzymes [BR:suk01000]
 1. Oxidoreductases
  1.4  Acting on the CH-NH2 group of donors
   1.4.4  With a disulfide as acceptor
    1.4.4.2  glycine dehydrogenase (aminomethyl-transferring)
     SAA6008_01505 (gcvPA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
Position
complement(1622251..1623597)
Genome map
AA seq 448 aa AA seqDB search
MSHRYIPLTEKDKQEMLQTIGAKSIGELFGDVPSDILLNRDLNIAEGEAETTLLRRLNRI
ASKNITKETHTSFLGAGVYDHYAPSVVDAMISRSEFYTAYTPYQPEISQGELQAIFEFQT
LICELTDMDVANSSMYDGMTSFAEACILAFSQTKKNKIVVSKGLHYQALQVLHTYAKTRK
EFEVVEIDLDGTVTDLKKLEAAVDDETAAVAVQYPNFYGSIEDLEKIHSFIEDKKALFIV
YANPLALGLLTPPGLFGADIVVGDTQPFGIPAQFGGPHCGYFATTKKLMRKVPGRLVGQT
QDDEGNRGFVLTLQAREQHIRRDKATSNICSNQALNALASSIAMSALGKQGIYDIAVQNI
EHANYAKQQFIKKGFEVLDGTSFNEFVVKFDKPIQQVNEELVKYNIIGGFDLGVVSDDFK
NHMLIAVTELRTKDEIDTFVEKAGELND
NT seq 1347 nt NT seq  +upstreamnt  +downstreamnt
gtgagtcatcgttatatacctttaactgaaaaagacaagcaagaaatgttacaaacaatt
ggtgcaaaatctataggagaattattcggtgatgtaccaagtgacattttattaaataga
gatttaaatattgctgaaggcgaagcggaaacaacgttacttagaagattaaatcgcatt
gcaagcaagaatatcactaaagaaacgcatacatcatttttgggtgctggtgtttatgat
cattacgcgccatcagttgtggatgctatgatttcaagatcagaattttacacagcatat
acgccatatcaaccggaaatttctcaaggtgaattacaagccatttttgagttccaaact
ttaatttgtgaattaacagatatggatgtagcaaattcttctatgtatgatgggatgact
agctttgctgaagcatgtatcttagcatttagtcaaacaaagaaaaataaaattgtagtc
tcaaaaggtttacattatcaagcattacaagtacttcatacttatgctaagacgcgtaag
gaattcgaagtagtggaaatcgatttagatggcactgttacagatttgaaaaaattagaa
gcagcagtggatgatgaaacagcagctgttgcagtacaatatccaaacttttacggttca
attgaagatcttgaaaagattcatagctttattgaagataaaaaagcattatttatcgta
tatgcaaatccattagcattgggattacttacacctccaggtttatttggtgcagatatt
gttgtaggtgatactcagccattcggaattcctgctcaattcggtgggccacattgtgga
tattttgcaacgacgaaaaagttaatgcgtaaagtgccaggtagattagtcggtcaaaca
caagatgatgaaggtaatcgtggctttgtattaacattacaagcacgtgaacaacatatt
cgacgcgataaagcgacatctaatatttgttctaaccaagcattaaatgctttagcgtca
tcaattgcaatgtcagcacttggtaaacaaggtatctatgatattgcagttcaaaatata
gaacatgctaactatgctaaacaacaatttattaaaaaaggttttgaagtattagatggt
acatctttcaatgagtttgtagtcaaatttgacaaaccaattcaacaagttaacgaggaa
ttagtgaagtacaatattatcggtggttttgatttaggtgttgtttcagacgactttaaa
aatcacatgttaatagctgtaactgaattaagaacaaaagatgaaatcgatacatttgta
gaaaaggctggtgagttaaatgactag

DBGET integrated database retrieval system