KEGG   Staphylococcus aureus subsp. aureus JKD6008 (MRSA/VISA): SAA6008_01507Help
Entry
SAA6008_01507     CDS       T01886                                 

Gene name
aroK
Definition
(GenBank) shikimate kinase, AroK
  KO
K00891  
shikimate kinase [EC:2.7.1.71]
Organism
suk  Staphylococcus aureus subsp. aureus JKD6008 (MRSA/VISA)
Pathway
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Module
Shikimate pathway, phosphoenolpyruvate + erythrose-4P => chorismate
Brite
KEGG Orthology (KO) [BR:suk00001]
 Metabolism
  Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    SAA6008_01507 (aroK)
Enzymes [BR:suk01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.71  shikimate kinase
     SAA6008_01507 (aroK)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
Position
complement(1624867..1625391)
Genome map
AA seq 174 aa AA seqDB search
MNHDKSPIILIGFMGTGKSTIGKYVADEQNLSFIDIDSYIEEKYKLTIPEIFCKHGEQYF
RNLEFTCLQECINTADIIATGGGIIESEEAFNFLKNQKNIIWLDCNIDIIYSRINDDPHR
PNANNKTIKQLNDLYCSRNLRYNEIAFKKFDSHLLSISEIYYELLNLIKASDQY
NT seq 525 nt NT seq  +upstreamnt  +downstreamnt
atgaatcatgataaatcaccaataattttaattggtttcatgggtaccggtaaatctacg
attggtaaatacgttgcagatgagcaaaatttatcatttattgatatagattcatatatc
gaagagaagtataagttaacaataccagaaatattttgtaaacatggtgaacaatatttc
aggaatttagagttcacatgtttgcaagaatgtattaacactgcagatataattgctact
ggtggtggtattattgagagtgaagaggcatttaattttttgaaaaatcaaaaaaacatt
atttggttagattgtaatattgatattatatatagtcgaatcaatgatgacccacatcga
cctaatgcaaataataagacaatcaagcagttaaatgacttgtattgctcgcggaattta
agatataatgaaatcgcattcaagaaatttgatagtcatttgctatcaatttcagaaata
tattatgaattgctaaatttaataaaagcgagtgatcagtattag

DBGET integrated database retrieval system