KEGG   Staphylococcus aureus subsp. aureus JKD6008 (MRSA/VISA): SAA6008_01514Help
Entry
SAA6008_01514     CDS       T01886                                 

Definition
(GenBank) late competence protein, ComGA
  KO
K02243  
competence protein ComGA
Organism
suk  Staphylococcus aureus subsp. aureus JKD6008 (MRSA/VISA)
Module
Competence-related DNA transformation transporter
Brite
Secretion system [BR:suk02044]
 Type II secretion system
  Competence-related DNA transformation transporter (DNA-T) core components [MD:M00429]
   SAA6008_01514
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
Position
complement(1628116..1629090)
Genome map
AA seq 324 aa AA seqDB search
MKILFQEIINKAIEMKASDVHFIPVKNEVSIKFRINDNLEQYEQIGNSIYQKLLVYMKFQ
AGLDVSTQQVAQSGRYSYLFNKIYFLRISTLPLSLGQESCVIRIVPQFFQPQKSTYKFND
FKHLMNKKQGLLLFSGPTGSGKSTLMYQMVSYANKALNLNVISIEDPVEMQIPGIVQINV
NDKAGINYVNSFKAILRCDPDVILIGEIRDKDVAKCVIQASLSGHLVLTTLHATDCKGAI
LRLLEMGISVQELIQATNLIINQRLVTTIKQQRQLVCEILSQQQLRYFFSHNHSLPSSFK
NLEDKLDDMTKAGVICETTMHKYI
NT seq 975 nt NT seq  +upstreamnt  +downstreamnt
ttgaagattctatttcaagaaataattaataaagcgatagaaatgaaagcgagtgatgta
cattttattccagttaaaaatgaagtaagtattaaatttagaattaatgataacttggag
cagtatgaacaaattgggaatagcatttatcaaaagttattagtttatatgaagtttcaa
gctgggcttgatgtttctacacagcaagtcgcacagagcggtcgatatagttaccttttc
aataaaatatattttttgagaatatcaactttaccattgtcacttggccaagaaagttgt
gttatcagaattgtacctcaattttttcaaccacagaaatcaacttataaattcaatgat
tttaaacacctcatgaataagaaacaaggattactattgtttagtggaccaactggttca
ggaaagagtacattaatgtatcaaatggtctcatacgcgaataaagccttgaatttaaat
gtaatttctatagaggatcctgtagagatgcaaattcctggtatcgtccaaattaatgtg
aatgataaagctggcataaactatgtaaattcgtttaaagctattttaagatgtgatcct
gatgttattttaataggtgaaatcagagataaagatgttgccaagtgtgttatacaggct
agtttaagtggtcaccttgttctgactacattgcatgcaactgattgtaaaggtgctatt
ttaaggctattagaaatgggcatttctgtacaagaattgatacaggcaactaacttaatt
ataaaccaacgacttgtaactactattaagcaacagcgacaattagtatgtgaaattcta
tctcagcaacaactccgatatttcttttcccataatcattcattaccatcatcatttaag
aacttagaagataaacttgatgatatgacaaaagcaggtgtcatttgtgaaactacaatg
cataaatacatttaa

DBGET integrated database retrieval system