KEGG   Staphylococcus aureus subsp. aureus JKD6008 (MRSA/VISA): SAA6008_01515Help
Entry
SAA6008_01515     CDS       T01886                                 

Definition
(GenBank) metallo-beta-lactamase superfamily protein
Organism
suk  Staphylococcus aureus subsp. aureus JKD6008 (MRSA/VISA)
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
Position
complement(1629142..1629765)
Genome map
AA seq 207 aa AA seqDB search
MRISSLTLGLVDTNTYFIENDKAVILIDPSGESEKIIKKLNQINKPLKAILLTHAHFDHI
GAVDDIVDRFDVPVYMHEAEFDFLKDPVKNGADKFKQYGLPIITSKVTPEKLNEGSTEIE
GFKFNVLHTPGHSPGSLTYVFDEFAVVGDTLFNNGIGRTDLYKGDYETLVDSIQDKIFEL
EGDLPLFPGHGPYTTVDDEQLNPFLHG
NT seq 624 nt NT seq  +upstreamnt  +downstreamnt
atgaggatttcaagcttaactttaggcttagttgatactaatacgtatttcatcgaaaat
gacaaagctgttattctgattgacccttcaggtgaaagtgaaaaaattattaaaaaatta
aaccaaataaataaaccgttaaaagctattttattaacacatgcacactttgatcatatc
ggagcagtcgatgatatagttgatcgattcgatgtcccggtttatatgcatgaagcagag
tttgattttctaaaagatcccgttaaaaatggggcagataaatttaagcaatatggatta
ccaattattacaagtaaggtaactcctgaaaagttaaacgaaggtagcacagaaatagaa
ggatttaagtttaatgtgttacacacacctggacattcaccaggaagtttaacatatgtg
ttcgatgaattcgcagttgttggagatacattatttaataatggaatcggacgtacagat
ttatataaaggtgattatgaaacgctagttgattctattcaagataaaatatttgaatta
gaaggcgatttacctttattccctggacatggtccatatacgacggttgatgatgaacaa
ttaaatccatttttacacggttaa

DBGET integrated database retrieval system