KEGG   Staphylococcus aureus subsp. aureus JKD6008 (MRSA/VISA): SAA6008_01523Help
Entry
SAA6008_01523     CDS       T01886                                 

Definition
(GenBank) zinc-specific metalloregulatory protein
  KO
K02076  
Fur family transcriptional regulator, zinc uptake regulator
Organism
suk  Staphylococcus aureus subsp. aureus JKD6008 (MRSA/VISA)
Brite
Transcription factors [BR:suk03000]
 Prokaryotic Type
  Helix-turn-helix
   Fur family
    SAA6008_01523
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
Position
complement(1636814..1637224)
Genome map
AA seq 136 aa AA seqDB search
MNTNDAIKILKENGLKYTDKRKDMLDIFVEEDKYINAKYIQQVMDENYPGISFDTIYRNL
HLFKDLGIIENTELDGEMKFRIACTNHHHHHFICEKCGDTKVIDYCPIDQIKLSLPGVNI
HKHKLEVYGVCESCQD
NT seq 411 nt NT seq  +upstreamnt  +downstreamnt
atgaatacaaatgatgctattaaaattttaaaagagaacggtttaaaatatacagataaa
cgtaaagatatgttagatatttttgtcgaagaagataagtatataaacgcaaagtatata
caacaagttatggatgaaaattatcctggaatttcattcgacacaatatatagaaacctg
cacttatttaaagatttaggaattattgaaaatacagaacttgatggtgaaatgaagttt
agaatcgcttgtacaaaccatcatcatcatcattttatctgtgaaaagtgtggagataca
aaggtaatagattattgtccaatagatcagataaaattatcactacctggtgttaatatt
cacaaacacaaacttgaagtttatggtgtatgtgagtcttgccaagattaa

DBGET integrated database retrieval system